Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2t29 Olfactory Receptor

Gene Symbol Or2t29
Organism Mouse
Family 2
Subfamily t
Pseudo No
Location chr11:58542521-58543474 (-)
Aliases Olfr329, MOR275-6P, MOR275-6P

Sequence information


Nucleotide sequence

ATGGACCTCACCACCTGGATGAACAACTCTACTGGACAGTCAGATTTCACCCTGGTGGGA
CTCTTCAGTCAATCCAAACACCCTGCCCTGCTTGCTGTGGTCATATTTGTGGTTTTCCTG
ATGGCCTTGTCTGGGAACGCCCTCCTGATCCTGCTGATACTCTCTGACACCCACCTTCAC
ACACCCATGTACTTTTTTATCAGCCAGCTGTCCCTCATGGACATGATGTACATTTCTGTC
ACTGTGCCCAAGATGCTCATGGACCAGGTCCTGGGGAGCCACAAGATCTCAGCTGCTGCC
TGTGGGATGCAGATGTTCCTCTACCTGACACTAGTAGGGTCAGAATTTTTTCTTCTGGCT
GCCATGTCTTATGACCGCTATGTGGCCATTTGTTATCCACTCCGGTATCCTGTCCTCATG
AACTACAGGGTTTGTCTCCTGCTGATGTCTGTGTGTTGGGTCCTGGGATCCTTGGATGGC
TTCATGCTCACCCCTGTCACCATGACTTTCCCATTCTGTGGGTCCCGGGAGATCCATCAC
TTCTTCTGTGAGGTTCCTGCTGTGACAAAGCTCTCCTGCTCAGACACCTGGCTCTATGAG
ACCCTCATGTATGTGTGCTGTGTGCTCATGCTTCTCATCCCTGTGACAGTCATTTCAGGC
TCCTATACATCCATCCTCCTCACTGTTCTCAGGATGAACTCAGCAGAGGGCAGGAAGAAG
GCCCTTGCCACCTGCTCCTCCCACATGACTGTGGTCACCCTCTTCTATGGCGCTGCTGTC
TATACCTACATGCTCCCTGCCTCTCTCCACACCCCTGAGAAGGACATGGTGGTGTCTGTG
TTTTACACCATACTCACCCCTCTTTTGAACCCACTAATCTATAGTCTTAGGAATAAGAAT
GTCACAGAAGCTATGAAGAAACTGTTGGGTGAAAACCCCTCTTTCCAGAAACAG


Conceptual translation

MDLTTWMNNSTGQSDFTLVGLFSQSKHPALLAVVIFVVFLMALSGNALLILLILSDTHLH
TPMYFFISQLSLMDMMYISVTVPKMLMDQVLGSHKISAAACGMQMFLYLTLVGSEFFLLA
AMSYDRYVAICYPLRYPVLMNYRVCLLLMSVCWVLGSLDGFMLTPVTMTFPFCGSREIHH
FFCEVPAVTKLSCSDTWLYETLMYVCCVLMLLIPVTVISGSYTSILLTVLRMNSAEGRKK
ALATCSSHMTVVTLFYGAAVYTYMLPASLHTPEKDMVVSVFYTILTPLLNPLIYSLRNKN
VTEAMKKLLGENPSFQKQ