Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2t46 Olfactory Receptor

Gene Symbol Or2t46
Organism Mouse
Family 2
Subfamily t
Pseudo No
Location chr11:58580846-58581823 (+)
Aliases Olfr325, RP23-128D9.3, MOR275-5, RP23-128D9.3, MOR275-5

Sequence information


Nucleotide sequence

ATGGACCTCACCACCTGGATGAACAACTACACTACACAGTCAGATTTCACCCTGGTGGGA
TTCTTCAGTCAATCCAAACACCCTGTCCTGCTTGCTGTGGTCATATTTGTGGTTTTCCTG
ATGGCCTTGTCTGGGAACGCCCTCCTGATCCTGCTGGTACTCTCTGACACCCACCTTCAC
ACACCAATGTACTTTTTTATCAGCCAGCTGTCCCTCATGGACATGATGTACATTTCTGTC
ACTGTGCCCAAGATGCTCATGGACCAGGTCCTGGGGAGCCACAAGATCTCAGCTGCTGCC
TGTGGGATGCAGATGTTCCTCTACCTGACATTAGCAGGGTCAGAATATTTGCTTCTAGCT
GCCATGTCTTATGACCGCTATGTAGCCATCTGTCATCCACTCCGGTATCCTGTCCTCATG
AACCACAGGGTGTGCCTCCTGCTGATGTCTTTATGTTGGATCCTGGGATCCTTGGATGGC
TTCATGCTCACCCCTATCACCATGACTTTCCCATTCTGTGGATCCCGGGAGATCCATCAC
TTCTTCTGTGAGGTTCCTGCTGTGACAAAGCTCTCCTGCTCAGACACCTGGCTCTATGAG
ACCCTCATGTATGTGTGCTGTGTGCTCATGCTTCTCATCCCTGTGACAGTCATTTCAGGC
TCCTATACATCCATCCTCCTCACTGTTCTCAGGATGAACTCAGCAGAGGGCAGGAAGAAG
GCCCTTGCCACCTGCTCCTCCCACATGACTGTGGTCACCCTCTTCTATGGCGCTGCTGTC
TATACCTACATTTTCCCTGCCTCCCTCCACAGCCCTGAGAAGGACATGGTGGTGTCTGTG
TTTTACACCATACTCACCCCTCTGTTGAACCCACTGATCTATAGTTTTAGGAATAAGAAT
GTCACAGAGGCTATGAAGAAACTGTTGGGTGTGAAACCCTTCTTTCAAGAATCTTTAAAG
GAAGTCATTTATAAAGAA


Conceptual translation

MDLTTWMNNYTTQSDFTLVGFFSQSKHPVLLAVVIFVVFLMALSGNALLILLVLSDTHLH
TPMYFFISQLSLMDMMYISVTVPKMLMDQVLGSHKISAAACGMQMFLYLTLAGSEYLLLA
AMSYDRYVAICHPLRYPVLMNHRVCLLLMSLCWILGSLDGFMLTPITMTFPFCGSREIHH
FFCEVPAVTKLSCSDTWLYETLMYVCCVLMLLIPVTVISGSYTSILLTVLRMNSAEGRKK
ALATCSSHMTVVTLFYGAAVYTYIFPASLHSPEKDMVVSVFYTILTPLLNPLIYSFRNKN
VTEAMKKLLGVKPFFQESLKEVIYKE