Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or2t6 Olfactory Receptor

Gene Symbol Or2t6
Organism Mouse
Family 2
Subfamily t
Pseudo No
Location chr14:14175133-14176080 (-)
Aliases Olfr720, MOR274-2, MOR274-2

Sequence information


Nucleotide sequence

ATGGATGGAAACAAAACCTTTCCCAGTGACTTCACCTTTGTGGGACTCTTTACTCACAAC
AAAGCCTCAGGATTCCTGTTCAGTGTCATATGTGCCACGTTCTTCATGGCCATATTGGCA
AATGGGGTTATGATCTTTCTCATTCACATAGACCCTCACCTCCACACCCCCATGTACTTC
CTCCTCAGCCACCTCTCCTTCATTGACATGATGTATATCTCCACTATTGTGCCTAAGATT
TTGGTTGATTACATTGTAGGCAAAGGGATCATCTCTTTTGCTGCCTGTACAGCCCAGTAC
TTTCTCTACATGGGCTTTGTAGGGGCCGAGTTCTTCCTGCTGGGACTTATGGCCTATGAC
CGCTACGTGGCCATCTGTAATCCGCTCCGTTATCCTGTCCTCATGAGTCGGAGGGTCTGC
TGGTTTATTTTGGCCAGCTCTTGGTTCGGTGGGGCTTTGGACAGTTTCCTTCTCACTCCC
ATCACCATGAGTCTCCCATTCTGTGCATCCCACAAGATTAATCACTTTTTCTGCGAGGCT
CCCACAATGCTGAGGCTGGCCTGTGGTGACAAAGCCATATATGAAATGGTGATGTATATC
TGCTGTGTTGTAATGCTGTTGGTCCCCTTCTCTGTGGTGATCACATCTTATGCCCAGATA
CTGGTCACAGTACATCACATAAAGTCTGAAGAAGGGAGGAAGAAGGCTTTTGCCACCTGC
TCATCACATGTGATTGTGGTGACATTGTTTTATGGGGCTGCTTTGTACACCTATATGCTT
CCCCAAGCCTATCACACCCCACTCAAAGATAAAATCTTCTCAGCCTTTTATACCATCCTC
ACCCCCTTGCTCAACCCTGTTATTTATAGTCTGAGGAACAGAGATGTGGCAGGGGCTTTA
AAGAGGGTGATAGCAAGACACAGAGGAGCCTGCAGTGTGGAAAGAAAA


Conceptual translation

MDGNKTFPSDFTFVGLFTHNKASGFLFSVICATFFMAILANGVMIFLIHIDPHLHTPMYF
LLSHLSFIDMMYISTIVPKILVDYIVGKGIISFAACTAQYFLYMGFVGAEFFLLGLMAYD
RYVAICNPLRYPVLMSRRVCWFILASSWFGGALDSFLLTPITMSLPFCASHKINHFFCEA
PTMLRLACGDKAIYEMVMYICCVVMLLVPFSVVITSYAQILVTVHHIKSEEGRKKAFATC
SSHVIVVTLFYGAALYTYMLPQAYHTPLKDKIFSAFYTILTPLLNPVIYSLRNRDVAGAL
KRVIARHRGACSVERK