Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or3a4 Olfactory Receptor

Gene Symbol Or3a4
Organism Mouse
Family 3
Subfamily a
Pseudo No
Location chr11:74053825-74054757 (-)
Aliases Olfr399, RP23-221M24.2, MOR255-1, RP23-221M24.2, MOR255-1

Sequence information


Nucleotide sequence

ATGGATCTGGGAACCTTGGGAAACGATTCCTGTGTGAGCACATTTGTCCTACTGGGTCTC
ACAGAGACTCCAGTTTTGCGGCCCATCCTCTTTGTCATCTTCCTTCTTGCTTATGTAGCT
ACGCTTGGTGGCAATTTCAGCATCCTGGCTGCTATCATTATAGAGCCCAAACTCCACACT
CCCATGTATTTCTTCTTGGGGAACTTGTCTATGCTGGATGTTGGATGCATTAGTGTCACT
GTTCCTGCCATGTTGAAACATTTTCTATCCAATGACAGACACATTCCCTATGGGGCCTGC
CTCTCACAGCTCTTCTTCTTCCATCTCCTGGCTGGGGCAGACTGCTTCCTTCTGACTGTC
ATGGCCTATGATCGTTATCTGGCTATCTGCCACCCCCTCACCTACAACACCCATATGAGT
TGGAGGATTCAGAAGGCCTCAGTGTGCCTGTCATGTGTGTTTTCCTTTAGTAATGCACTG
ACCCAAACTGTTGCCTTATCTACTCTTAAATTCTGTGGTCCAAACACAATCAACCACTTC
TACTGTGACCTCCCTCAGCTCTTTCAGCTTTCCTGTTCCAGCATCCAACTCAATGAGCAG
CTGCTCTTTGTAGCAGCAGCCTTCATGGGTGTGGTCCCCTTGGTCCTCATTACTGTGTCA
TATGGCCATGTGGCAGCTGCAGTTCTTCGTATCCGGTCTGCTGAGGGCAGGAAGAAAGCC
TTCTCTACCTGCAGCTCTCATCTCACTGTGGTAGGCATCTTCTATGGGACAGGGGTCTTC
AGCTACATGCGTCTGGGGTCAGTGGAATCTTCAGACAAGGACAAAGGCATTGGCATCCTC
AACACTGTCATCAGTCCCATGCTGAACCCACTTATCTACAGCCTTAGGAACCCTGATGTG
CAGGGTGCCCTACGGAAGGTGCTCACAGGGAGG


Conceptual translation

MDLGTLGNDSCVSTFVLLGLTETPVLRPILFVIFLLAYVATLGGNFSILAAIIIEPKLHT
PMYFFLGNLSMLDVGCISVTVPAMLKHFLSNDRHIPYGACLSQLFFFHLLAGADCFLLTV
MAYDRYLAICHPLTYNTHMSWRIQKASVCLSCVFSFSNALTQTVALSTLKFCGPNTINHF
YCDLPQLFQLSCSSIQLNEQLLFVAAAFMGVVPLVLITVSYGHVAAAVLRIRSAEGRKKA
FSTCSSHLTVVGIFYGTGVFSYMRLGSVESSDKDKGIGILNTVISPMLNPLIYSLRNPDV
QGALRKVLTGR