Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4a39 Olfactory Receptor

Gene Symbol Or4a39
Organism Mouse
Family 4
Subfamily a
Pseudo No
Location chr2:89406133-89407077 (-)
Aliases Olfr1238, RP24-427F7.5, MOR231-11, RP24-427F7.5, MOR231-11

Sequence information


Nucleotide sequence

ATGGGACAGAGAAACAATGTCACAGAATTTATCCTCCTGGGACTCACTCAGGATCCAGCT
GGACAGAAAGCATTGTTTGTCATGTTTTTACTCATCTACATCGTGACAATGGTGGGCAAC
CTGCTTATTGTGGCCACAGTGATTGCCAGTCCCTCCTTGGGCTCCCCAATGTACTTCTTC
CTTGCTTATTTGTCAATCATGGATGCTGTTTATTCCACTTCCACATCACCCAAGTTGATT
ATGGACTTACTCTCCGACAAAAAGACTATCTCATTCTCAGCTTGCATGGGCCAACTCTTT
ATTGAGCACTTATTTGGTGGTGCTGAGGTCTTCCTGCTGGTGGTGATGGCCTACGATCGC
TATGTGGCCATCTGTAAGCCCCTTCACTATTTGACCATCATGAACCGGCAGATTTGCATT
CTTCTGTTGGTGATAGCCTGGGTTGGTGGGTTTGTACATTCTGTGATTCAACTTGCTTTT
GTGTCTACTCTCCCTTTCTGTGGACCCAATGTCATTGATCACTTTATCTGTGACATGTAC
CCACTCTTGACACTTGCATGCAGTGACACTTACTTCATTGGACTTACTGTGGTTGCGAAT
GGTGGAGCAATCTGTATGGTCATTTTAATTCTTCTTCTAATCTCTTATGTATTCATCCTA
AACTCTCTTAAAAACTACAGTCAGGAAGGGAGACGCAAAGCCTTATCCACTTGCAGCTCC
CACATCACTGTGGTGGTGCTCTTTTTTGTCCCCTGCATTTTTATTTATGTTAGGCCAGTG
TCTAACTTTCCCATTGATAAGTCGATAAGTGTAGTTTTTACAGTTATTACTCCCATGCTG
AACCCTTTAATATATACTCTGAGAAATTCAGAGATGAAAATTGCAATGCAAAAACTCTGG
TGTAAAACAGCAACTACAGGCAGAGTAAGAGTGCACTCCCCACAC


Conceptual translation

MGQRNNVTEFILLGLTQDPAGQKALFVMFLLIYIVTMVGNLLIVATVIASPSLGSPMYFF
LAYLSIMDAVYSTSTSPKLIMDLLSDKKTISFSACMGQLFIEHLFGGAEVFLLVVMAYDR
YVAICKPLHYLTIMNRQICILLLVIAWVGGFVHSVIQLAFVSTLPFCGPNVIDHFICDMY
PLLTLACSDTYFIGLTVVANGGAICMVILILLLISYVFILNSLKNYSQEGRRKALSTCSS
HITVVVLFFVPCIFIYVRPVSNFPIDKSISVVFTVITPMLNPLIYTLRNSEMKIAMQKLW
CKTATTGRVRVHSPH