Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4b1d Olfactory Receptor

Gene Symbol Or4b1d
Organism Mouse
Family 4
Subfamily b
Pseudo No
Location chr2:90138214-90139137 (-)
Aliases Olfr32, RP23-226K16.2, MOR227-7P, MOR227-9_p, MTPCR05, RP23-226K16.2, MOR227-7P, MOR227-9_p, MTPCR05

Sequence information


Nucleotide sequence

ATGGCCTTTGTAAATGTGACTGAGTTGATCATCACTGGCCTTTTCCAGGATCCAGATGTG
CAGAAGGTGTGCTTTGTGCTGTTCCTTCCTGTGTACCTGGCCACAGTGTTGGGCAATGGC
CTCATTGTTGTGACAGTCAACATCAGTAAGAGTCTGTATTCCCCCATGTATTTCTTCCTC
AATTACTTGTCCTTGGTGGAGATCCTCTACTCCTCTACTGTTGTCCCTAAGTTCATCACT
GATTTACTTAACAAGATTAAAACCATCTCTCCAAAGGGCTGCCTAGCTCAGATTTTCTTC
TTCCACTTCTTTGGGGTCACTGAGATTCTCTTGCTTACAGTGATGGCTTATGACCGCTAT
GTGGCCATCTGCAAACCTCTTTACTACACAACTATCATGAGTAGGCCCAAATGTCACCGG
CTGGTGGCTGGTTCTTGGGTGGGGGGATTTTTTCATTCTATAATTCAGATTTTCATCACT
CTCCCTTTGCCTTTCTGTGGTCCCAATGTGATTGACCATTACTTCTGTGACCTCCATCCC
TTATTCAAGTTGGCCTGCACTGACACTTTTGTGGTGGGGGTTATTATGTTTGTTAACAGT
GGATTATTTTCTGTATTTTCCTTTCTTTTCTTGGTGTCCTCTTACATTGTTATCCTGTAT
AACTTGAGGAACCATTCTGCAGAGGGGAGACGCAAGGCTTTATCTACCTGTGCCTCTCAC
ATCATGGTGGTTGTCTTGTTCTTTGGACCTGCCATCTTCCTCTACTTGAGACCTGCCTCC
ACCTACACTGAAGACAAGCTTGTGGCTGTGTTCTACACGGTCATCACCCCTATGCTGAAT
CCCATCATCTACACACTCAGAAATGCAGAGGTGAAAAATGCTGTGAGGAAGTTGTGGGGC
AAAAAAGTGAGCTCAAGTTTGGAA


Conceptual translation

MAFVNVTELIITGLFQDPDVQKVCFVLFLPVYLATVLGNGLIVVTVNISKSLYSPMYFFL
NYLSLVEILYSSTVVPKFITDLLNKIKTISPKGCLAQIFFFHFFGVTEILLLTVMAYDRY
VAICKPLYYTTIMSRPKCHRLVAGSWVGGFFHSIIQIFITLPLPFCGPNVIDHYFCDLHP
LFKLACTDTFVVGVIMFVNSGLFSVFSFLFLVSSYIVILYNLRNHSAEGRRKALSTCASH
IMVVVLFFGPAIFLYLRPASTYTEDKLVAVFYTVITPMLNPIIYTLRNAEVKNAVRKLWG
KKVSSSLE