Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c10 Olfactory Receptor

Gene Symbol Or4c10
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89929811-89930743 (+)
Aliases Olfr1258, RP24-166A20.2, MOR232-3, RP24-166A20.2, MOR232-3

Sequence information


Nucleotide sequence

ATGGAAATTAGGAGCAATGTGACAGAGTTTGTTCTCTTGGGGCTCACCAGAAACCCAAGC
ATGCAGAAAATCGTGTTTGCTGTATTTGTCGTCATCTACATCATCTCCATGGTAGGCAAT
GTGCTCATTGTGGTCACTATCACTGCCAGTCCATCGCTGGGCTCCCCTATGTACTTTTTC
TTAGCGTATCTCTCTTTCATTGATGCCTGTTATTCCTCTGTCAACACTCCTAAATTGATC
ATAGACTCACTCCATGAAAAAAAGACAATACTATTCAATGGATGCATGACCCAGGTCTTT
GGGGAGCATTTCTTTGGAGGTGCTGAGGGCATCCTGCTTACTGTGATGGCCTATGACCGC
TATGTGGCAATCTGCAAGCCCTTACACTATACAACCATCATGAGCAGAAGGGTATGTGGC
CTGCTGGTAGGAGTGGTATGGGTCGGAGGTTTTCTTCATGCAACCATACAGATTCTGTTT
ATTTTTAAATTACCTTTCTGTGGCCCAAATGTCATAGATCACTTTATGTGTGATCTGAAC
CCTTTGCTTAACCTTGCATGCACTGATACCCACATTCTGGGGCTCTTTGTTGCTGCCAAC
AGTGGTTTTATTTGTCTGTTGAACTTCCTCCTTCTGTTGGTCTCCTATGTGGTCATTCTA
CGTTCATTAAGAAACCACAGTGCAGAGGGGAGGCGCAAAGCCCTCTCCACTTGTGTCTCC
CACATAACAGTTGTTGTCTTGTTTTTCGTACCCTGCATTTTTGTGTACATGAGACCTTCA
GCCACTTTGTCTATTGATAAAGCAGTTGCTGTCTTCTACACTATGATAACTCCCTTGTTA
AATCCTTTAATCTACACCTTGAGAAATGCTCAGATGAAAGATGCCATTAAGAAATTGTGT
AGATGGAAAGATGATGTTATTTCCATCAACAAA


Conceptual translation

MEIRSNVTEFVLLGLTRNPSMQKIVFAVFVVIYIISMVGNVLIVVTITASPSLGSPMYFF
LAYLSFIDACYSSVNTPKLIIDSLHEKKTILFNGCMTQVFGEHFFGGAEGILLTVMAYDR
YVAICKPLHYTTIMSRRVCGLLVGVVWVGGFLHATIQILFIFKLPFCGPNVIDHFMCDLN
PLLNLACTDTHILGLFVAANSGFICLLNFLLLLVSYVVILRSLRNHSAEGRRKALSTCVS
HITVVVLFFVPCIFVYMRPSATLSIDKAVAVFYTMITPLLNPLIYTLRNAQMKDAIKKLC
RWKDDVISINK