Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c10b Olfactory Receptor

Gene Symbol Or4c10b
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89,880,800-89,881,800 (+)
Aliases Olfr1257

Sequence information


Nucleotide sequence

MENQNNVTEFILLGLTENPKMQKIVFIMFFLIYIISITGNVLIVVTITSTSLLESPMYFF
LAYLSFIDACYSSVSTPKLIADSLCEKKTIPFNGCMTQIFGEHLFGGAEIILLTVMAYDR
YVAICKPLHYATIMSRRLCSLLVGVSWLGGFLHATIQILFIFQLPFCGPNIIDHFMCDLN
PLLNLVCTDTHTLGIFVAANSGFICLLNFLLLLVSYVAILRSLKNHSAEGRRKALSTCIS
HITVVVLFFVPCIFVYMRPVATLPIDKAVAMFYTMITPMLNPLIYTLRNAQMKDAIKKLG
STKILSSNK


Conceptual translation

MENQNNVTEFILLGLTENPKMQKIVFIMFFLIYIISITGNVLIVVTITSTSLLESPMYFF
LAYLSFIDACYSSVSTPKLIADSLCEKKTIPFNGCMTQIFGEHLFGGAEIILLTVMAYDR
YVAICKPLHYATIMSRRLCSLLVGVSWLGGFLHATIQILFIFQLPFCGPNIIDHFMCDLN
PLLNLVCTDTHTLGIFVAANSGFICLLNFLLLLVSYVAILRSLKNHSAEGRRKALSTCIS
HITVVVLFFVPCIFVYMRPVATLPIDKAVAMFYTMITPMLNPLIYTLRNAQMKDAIKKLG
STKILSSNK