Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4c12b Olfactory Receptor

Gene Symbol Or4c12b
Organism Mouse
Family 4
Subfamily c
Pseudo No
Location chr2:89,816,300-89,817,300 (+)
Aliases Olfr1255

Sequence information


Nucleotide sequence

MNDTEHMENKRNVTEFILIGLTQNPQMQKVVFVTFLLLYMITISGNLLIVVTVINSQALN
SPMYFFLSHLSLIDTIYTSSSAPKLIADSLQENKVISFNGCMAQVYAEHIFGATEIILLT
VMAYDRYVAICKPLHYMTIMSHKLCILLVGVAWTGGFLHATIQILFTVWLPFCGPNIIDH
FMCDLYPLLELVCMDTHTLGLFVAANSGFICLFNFLLLMGSYVIILRSLKNYSLEGRRKA
LSTCVSHITVVVLSFIPCIFVYLRPVTTLPIDKAVAVFYTLVAPLLNPLIYTLRNSEVKN
AIKKLWRKKI


Conceptual translation

MNDTEHMENKRNVTEFILIGLTQNPQMQKVVFVTFLLLYMITISGNLLIVVTVINSQALN
SPMYFFLSHLSLIDTIYTSSSAPKLIADSLQENKVISFNGCMAQVYAEHIFGATEIILLT
VMAYDRYVAICKPLHYMTIMSHKLCILLVGVAWTGGFLHATIQILFTVWLPFCGPNIIDH
FMCDLYPLLELVCMDTHTLGLFVAANSGFICLFNFLLLMGSYVIILRSLKNYSLEGRRKA
LSTCVSHITVVVLSFIPCIFVYLRPVTTLPIDKAVAVFYTLVAPLLNPLIYTLRNSEVKN
AIKKLWRKKI