Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4d1 Olfactory Receptor

Gene Symbol Or4d1
Organism Mouse
Family 4
Subfamily d
Pseudo No
Location chr11:87,914,000-87,914,900 (-)
Aliases Olfr464

Sequence information


Nucleotide sequence

MEPQNITWVSEFILLGFSQTQELQKLLFVVFLCVYITTVVGNILIMITVTFDPRLDMPMY
FLLRNLAVIDLSYSTVTSPKMLVDFFHKTKTISYQGCMAQIFFFHLLGGGTVFFLSVMAY
DRYIAISQPLHYVTIMNTKLCVGLVVASWVGGFAHSIVQLSLMLPLPFCGPNVLDNFYCD
VPQVLRLACTDTSLLEFLMISNSGMLVLIWFLLLLISYTVILVMLRSHSGQARRKAASTC
TTHIIVVSMIFIPCIYIYSRPFTPFPLDKAVSISYTVLTPMLNPMIYTLRNQEMQAAMKR
LAEHLVLTKRNEL


Conceptual translation

MEPQNITWVSEFILLGFSQTQELQKLLFVVFLCVYITTVVGNILIMITVTFDPRLDMPMY
FLLRNLAVIDLSYSTVTSPKMLVDFFHKTKTISYQGCMAQIFFFHLLGGGTVFFLSVMAY
DRYIAISQPLHYVTIMNTKLCVGLVVASWVGGFAHSIVQLSLMLPLPFCGPNVLDNFYCD
VPQVLRLACTDTSLLEFLMISNSGMLVLIWFLLLLISYTVILVMLRSHSGQARRKAASTC
TTHIIVVSMIFIPCIYIYSRPFTPFPLDKAVSISYTVLTPMLNPMIYTLRNQEMQAAMKR
LAEHLVLTKRNEL