Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4d11 Olfactory Receptor

Gene Symbol Or4d11
Organism Mouse
Family 4
Subfamily d
Pseudo No
Location chr19:12,035,800-12,036,700 (-)
Aliases Olfr1423

Sequence information


Nucleotide sequence

MELRNDTRVKEFIFLGLTQSQHLSLVLCLVLCFVYVTTLLGNLLIMIIVTFESRLHTPMY
FLLRNLAVLDICFSSITAPKVLVDLLAKKKTISYAKCMTQMFFFHLLGGADIFSLSVMAF
DRYMAISKPLHYVTIMSSKRCTALIAASWVGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VPQVLKLACTDTFVLELLMISNNGLVTTLWFIFLLVSYMVILMMLRSQAGEDRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAIRR
LKRKLTPLEK


Conceptual translation

MELRNDTRVKEFIFLGLTQSQHLSLVLCLVLCFVYVTTLLGNLLIMIIVTFESRLHTPMY
FLLRNLAVLDICFSSITAPKVLVDLLAKKKTISYAKCMTQMFFFHLLGGADIFSLSVMAF
DRYMAISKPLHYVTIMSSKRCTALIAASWVGGFVHSIVQISLLLPLPFCGPNVLDTFYCD
VPQVLKLACTDTFVLELLMISNNGLVTTLWFIFLLVSYMVILMMLRSQAGEDRRKAISTC
TSHITVVTLHFVPCIYVYARPFTALPTDKAISVTFTVISPLLNPLIYTLRNQEMKSAIRR
LKRKLTPLEK