Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4f7 Olfactory Receptor

Gene Symbol Or4f7
Organism Mouse
Family 4
Subfamily f
Pseudo No
Location chr2:111,814,000-111,815,000 (-)
Aliases Olfr1303

Sequence information


Nucleotide sequence

MIFLALISVSIVQLAEPMDGENHTVVSEFVFLGLTHSWEIQLLLLVLSSVLYILSMAGNI
LIVFSVTIDPHLHSPMYFLLACLSFIDLVACSVTSPKMVYDLFRKHKVISFGGCITQIFF
IHLVGGVEMVLLVAMAFDRYIAICKPLHYLTIMSPRVCVLFLGAAWGLGISHSLFQLAFL
IDLPFCGPNILDSFYCDLPKLLRLACKDTYKLQFMVTINSGFICVGSFLLLLISYIFILF
SVWKHSSGGSSKALSTLSAHITVVFLFFGPTLFIYTWPHPNSQIDKFLALFDAVLTPFLN
PVIYTFRNKEMKVVIRRVFKTLLTFRGIS


Conceptual translation

MIFLALISVSIVQLAEPMDGENHTVVSEFVFLGLTHSWEIQLLLLVLSSVLYILSMAGNI
LIVFSVTIDPHLHSPMYFLLACLSFIDLVACSVTSPKMVYDLFRKHKVISFGGCITQIFF
IHLVGGVEMVLLVAMAFDRYIAICKPLHYLTIMSPRVCVLFLGAAWGLGISHSLFQLAFL
IDLPFCGPNILDSFYCDLPKLLRLACKDTYKLQFMVTINSGFICVGSFLLLLISYIFILF
SVWKHSSGGSSKALSTLSAHITVVFLFFGPTLFIYTWPHPNSQIDKFLALFDAVLTPFLN
PVIYTFRNKEMKVVIRRVFKTLLTFRGIS