Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4k2 Olfactory Receptor

Gene Symbol Or4k2
Organism Mouse
Family 4
Subfamily k
Pseudo No
Location chr14:50,186,300-50,187,200 (-)
Aliases Olfr730

Sequence information


Nucleotide sequence

MMNVANKSVVTEFVLLGLSNSWELQIFFFIVFSLFYVATMVSNSMIVLIVISDSHLHSAM
YFLLTNLSIIDMSLASFATPKMIIDYLTDHKTISFDGCIAQIFFLHLFTGTEIILLMAMS
FDRYIAICKPLRYASIISPQVCIAFVVSSWVVGTMHSMSQVIFALTLPFCGPNKIDSFFC
DLPVVFQLSCVDTYVLGLFMISTSGIIALSCFILLFNSYIIVLVTIKHHSSKGSSKALST
CTAHFIVVFMFFGPCIFIYMWPQNSFVIEKILSVFYTIFTPIMNPVIYTLRNHEVNSAMR
KLRSKFLNFSTETPSHSL


Conceptual translation

MMNVANKSVVTEFVLLGLSNSWELQIFFFIVFSLFYVATMVSNSMIVLIVISDSHLHSAM
YFLLTNLSIIDMSLASFATPKMIIDYLTDHKTISFDGCIAQIFFLHLFTGTEIILLMAMS
FDRYIAICKPLRYASIISPQVCIAFVVSSWVVGTMHSMSQVIFALTLPFCGPNKIDSFFC
DLPVVFQLSCVDTYVLGLFMISTSGIIALSCFILLFNSYIIVLVTIKHHSSKGSSKALST
CTAHFIVVFMFFGPCIFIYMWPQNSFVIEKILSVFYTIFTPIMNPVIYTLRNHEVNSAMR
KLRSKFLNFSTETPSHSL