Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4m1 Olfactory Receptor

Gene Symbol Or4m1
Organism Mouse
Family 4
Subfamily m
Pseudo No
Location chr14:50319895-50320833 (-)
Aliases Olfr734, MOR242-1, MOR242-1

Sequence information


Nucleotide sequence

ATGGAACCTGCAAATGATACCACCGTGACCGAATTTATTCTCACTGGTCTATCTCAGACT
CGGGAAGTGCAGCTAGTCTTGTTTGTTATATTTTTATCCTTTTATTTATTCATACTTCCA
GTGAATATCCTTATTATCTGCACAATCAGGCTTGATTCCCATTTGAGTTCTCCCATGTAT
TTCCTGCTGGCTAATCTAGCCTTCCTTGATATTTGGTATTCCTCTATCACAGCGCCTAAG
ATGCTTGTAGACTTCTTTGTGGAAAGGAAGATAATATCCTTTGGTGGGTGTATTGCTCAA
CTCTTCTTCTTGCACTTTGTCGGGGCCTCTGAGATGTTCCTGCTGACAGTGATGGCTTTT
GACCGCTACGCTGCCATCTGCCGCCCTCTCCACTATGCTACCATCATGAACCGCCGGCTC
TGTTGTATCTTAGTGGCCCTCTCCTGGACAGGGGGCTTCGTACATTCTATAATACAGGTG
GCTCTCATTGTTCGACTCCCATTTTGTGGGCCCAATGAACTAGACAATTATTTTTGTGAC
ATCACTCAGGTTGTCCGGATTGCTTGTGCCAATACTTTCCTGGAAGAAATGGTCATGATC
TTTAGCAGTGGCCTGATCTCTGTGGTATGCTTCATTGCTCTGCTAATGTCCTACGCCTTT
CTTCTGACCATGCTTAAGAAACACTCAAGCTCAGGTGAGAGCACCAGCAGGGCTATATCC
ACTTGTTATTCCCACATCACCATAGTGGTGCTAATGTTTGGACCATCCATCTACATTTAT
GCTCGCCCATTTGACTCGTTTTCTCTAGATAAGGTGGTGTCTGTGTTTCATACTGTGATA
TTCCCTTTACTCAACCCCATCATCTATACATTGAGAAACAAGGAAGTGAAGGCAGCCATG
AGAAAGCTGGTGAATAGATATATTTTTTGCAAAGAAAAG


Conceptual translation

MEPANDTTVTEFILTGLSQTREVQLVLFVIFLSFYLFILPVNILIICTIRLDSHLSSPMY
FLLANLAFLDIWYSSITAPKMLVDFFVERKIISFGGCIAQLFFLHFVGASEMFLLTVMAF
DRYAAICRPLHYATIMNRRLCCILVALSWTGGFVHSIIQVALIVRLPFCGPNELDNYFCD
ITQVVRIACANTFLEEMVMIFSSGLISVVCFIALLMSYAFLLTMLKKHSSSGESTSRAIS
TCYSHITIVVLMFGPSIYIYARPFDSFSLDKVVSVFHTVIFPLLNPIIYTLRNKEVKAAM
RKLVNRYIFCKEK