Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4n4 Olfactory Receptor

Gene Symbol Or4n4
Organism Mouse
Family 4
Subfamily n
Pseudo No
Location chr14:50,281,300-50,282,300 (-)
Aliases Olfr732

Sequence information


Nucleotide sequence

METENRTVVTEFILIGLTQSHDIQRLVFVLSLIFYIIILPGNILIILTIRSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFFSEKKIISYKACITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHYSTVMSPRACYVMLLALWLGGFIHSIIQVVLILRLPFCGPNHLDNFFCD
VPQVIKLACTDTFAVELLMIFNSGLLTLLCFLGLLTSYAVILCHVHRSASEGKNKAISTC
TTHVIIIFIMFGPAIFIYTRPFTALSADKVVSFFHTVIFPLMNPVIYTLRNQEVKTSMKK
LIIRHIIC


Conceptual translation

METENRTVVTEFILIGLTQSHDIQRLVFVLSLIFYIIILPGNILIILTIRSDPGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFFSEKKIISYKACITQLFFLHFLGGGEGLLLVVMAF
DRYIAICRPLHYSTVMSPRACYVMLLALWLGGFIHSIIQVVLILRLPFCGPNHLDNFFCD
VPQVIKLACTDTFAVELLMIFNSGLLTLLCFLGLLTSYAVILCHVHRSASEGKNKAISTC
TTHVIIIFIMFGPAIFIYTRPFTALSADKVVSFFHTVIFPLMNPVIYTLRNQEVKTSMKK
LIIRHIIC