Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4n5 Olfactory Receptor

Gene Symbol Or4n5
Organism Mouse
Family 4
Subfamily n
Pseudo No
Location chr14:49894877-49895800 (-)
Aliases Olfr722, MOR241-3, MOR241-3

Sequence information


Nucleotide sequence

ATGGAGATCAAGAACAGCTCAGTAGTAACAGAATTCATCCTACTTGGCCTGACCCAGTCT
CAAGAAGCTCAACTCCTGGTCTTCGCACTGATTTCAGTTTTCTACCTAATAATTCTCCCT
GGAAATTTTCTTATCATTTTCACCATTAGATCAGACTCTGGACTCACAGCCCCACTTTAC
TTCTTTCTGGGAAACTTGGCATTCCTGGATGCCTCCTACTCTTTCATTGTAGCTCCTAGA
ATGCTTGTGGATTTCTTCTGTGAGAAAAAAGTCATTTCTTATAAAGCCTGCATCACTCAG
CTATTCTTTCTGCACTTTCTTGGAGCAGGAGAAATGTTTCTTCTTGTTGTGATGGCCGTT
GATCGTTATATCGCTATATGCCGTCCTTTATACTACTCCACTCTCATGAACCCTAGAGTC
TGTTATGCCTTATTGTTGGCTCTGTGGCTTGGGGGTTTTGCTCATTCCATTGTACAAGTG
GCTCTTATCCTAAACTTGCCCTTTTGTGGGCCAAACCAGCTGGATAACTTTTTCTGTGAT
GTTCCACAGGTTGTAAAGCTAGCCTGCACTGATACCTTTGCTGTGGAGCTCCTGATGGTT
TCTAACAGTGGTCTACTTACCCTCTTATGCTTCTTGGGACTTCTGGCCTCCTATGCTGTC
ATTCTCTACCACGTAAAAGGACATTCTTCTGAAGGGAAGAGCAAAGCCATCTCTACATGC
ACCACCCATATTATAATTGTGTTTCTCATGTTTGGGCCTGCCATTTTTATCTATACCCGC
CCCTTCCAGGCTCTCCAAGCTGACAAAGTTGTTTCCCTTTTCCACACGGTCATCTTTCCT
TTGATGAATCCTGTGATCTATACACTTCGCAACCAGGAAGTGAAAACTTCTATGAGGAAG
TTGTTAAGTCAGTATGTGATTTGC


Conceptual translation

MEIKNSSVVTEFILLGLTQSQEAQLLVFALISVFYLIILPGNFLIIFTIRSDSGLTAPLY
FFLGNLAFLDASYSFIVAPRMLVDFFCEKKVISYKACITQLFFLHFLGAGEMFLLVVMAV
DRYIAICRPLYYSTLMNPRVCYALLLALWLGGFAHSIVQVALILNLPFCGPNQLDNFFCD
VPQVVKLACTDTFAVELLMVSNSGLLTLLCFLGLLASYAVILYHVKGHSSEGKSKAISTC
TTHIIIVFLMFGPAIFIYTRPFQALQADKVVSLFHTVIFPLMNPVIYTLRNQEVKTSMRK
LLSQYVIC