Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4q3 Olfactory Receptor

Gene Symbol Or4q3
Organism Mouse
Family 4
Subfamily q
Pseudo No
Location chr14:50345379-50346440 (-)
Aliases Olfr735, MOR243-1, MOR243-1

Sequence information


Nucleotide sequence

ATGGTACACGCAGACAAGCAAGAAGTACTTTCTCATAATTTTTCATTTTTGTTTAATTTA
ACCTACTTAGTCCAGTTTAATTTTTCTTCCACTAGGTCGCTTGATACTCTTGGCTTGGAG
AAAAACAAAAACAGCTCTGATGTGTCACGATTTGTGCTTCTGGGCCTGTCGTCTTCCTGG
GAGCTCCAGTTGTTTCTCTTCTTCACATTTTTGTTGATTTACCTGGTTATTGTCCTGGGA
AATCTTTTGATAGTGATGGTCGTCCAGGCTGATGCTCACCTGTTCCAGTCACCCATGTAC
TATTTTCTAAGCCATCTGTCTTTCATTGACCTTTGCCTGAGCTGTGTGGCTGTACCCAAA
ATGCTAGGAGATTTCCTACAGAAGGAGAAGACAATATCTTTTTCAGGATGCCTGGCCCAG
GTATTCTTTCTTCACTTTCTTGGAGCCAGTGAGATGTTCCTGTTGACTGTTATGGCCTAT
GATAGGTATGTTGCCATATGCAACCCTTTGCACTACCTGACGGTCATGAATAACCACCTA
CGACTTCGGTTGGTGTTTGGCTGCTGGTGTGGAGGTTTCATTCACTCTATCACACAGGTC
ATGATTGTCATTCAGCTGCCTTTTTGTGGTCCCAATGAACTGGACAACTTCTACTGTGAT
GTCCCCCAGGTTGTCAAGCTGGCCTGCATGGACACTTACTTGGTTGAGGTGCTGATGGTC
TCTAACAGTGGCATACTGTCTCTTGTCTGCTTCTTGGTCCTGCTCTTCTCCTATGCTCTC
ATCTTGATTACTCTGAGAACTCACCTCCACCGGGGCCAGAGCAAGGCACTGTCCACCTGT
GCTTCTCACTTGACGGTGGTCAGCCTGATCTTTGTACCCTGTGTATTCATTTACTTGAGG
CCTTTCTGTACCTTCTCTGTGGATAAAGTAGTCTCTGTGTTTTACACAGTGATCACACCT
ATGCTGAACCCCCTCATCTATACACTCAGAAATGCAGACATGAAGCAAGCCATAGAAAAG
CTGAGAAAGAAGCAAGTGGCATCCCACTGCTTTGCTAAAGGA


Conceptual translation

MVHADKQEVLSHNFSFLFNLTYLVQFNFSSTRSLDTLGLEKNKNSSDVSRFVLLGLSSSW
ELQLFLFFTFLLIYLVIVLGNLLIVMVVQADAHLFQSPMYYFLSHLSFIDLCLSCVAVPK
MLGDFLQKEKTISFSGCLAQVFFLHFLGASEMFLLTVMAYDRYVAICNPLHYLTVMNNHL
RLRLVFGCWCGGFIHSITQVMIVIQLPFCGPNELDNFYCDVPQVVKLACMDTYLVEVLMV
SNSGILSLVCFLVLLFSYALILITLRTHLHRGQSKALSTCASHLTVVSLIFVPCVFIYLR
PFCTFSVDKVVSVFYTVITPMLNPLIYTLRNADMKQAIEKLRKKQVASHCFAKG