Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or4x6 Olfactory Receptor

Gene Symbol Or4x6
Organism Mouse
Family 4
Subfamily x
Pseudo No
Location chr2:90118670-90119644 (-)
Aliases Olfr1269, RP23-226K16.1, MOR228-3, RP23-226K16.1, MOR228-3

Sequence information


Nucleotide sequence

ATGAATTCTTCTTATCATTTCAGATTGTACCACCCACCTTGCTCCCTCATGGCTGACATA
CACAATGTGACTGAGTTCATTTTTCTGGGGCTCTCTTCCAATCAAGAGGTGCAGAAAGTT
TGCTTTGTGATATTTCTGCTCTTGTACATGGCCATTGTGCTTGGGAATCTTCTCATGGTG
GTCACTGTGGTAGCCAGCAGAAGTCTTGGATCCCCCATGTACTTCTTTCTTGGCTACCTC
TCCTTTGTGGAGATCTGCTACTCCTCCACAACAGCTCCCAAACTCATCTTGGATCTCCTA
GCTGAAAAAAAATCCATATCTGTATGGGGCTGCATGACACAGCTTTTCTTCATGCACTTC
TTTGGTGGCACTGAGATTTTCCTGCTCACAATGATGGCCTATGACCGTTATGTGGCCATC
TGCAAGCCCCTGCACTATACTAGCATCATGAACCAAAGTGTGTGTGCAGTCCTCATGGGA
ACAGCATGGATAGGAGGCTTTGTGCATTCCTTTGCTCAAATACTTCTCATCTTTCCTTTG
CCCTTCTGTGGCCCCAATATCATTGACCATTATTTCTGTGATTTGCTTCCTGTGCTTAAA
CTTGCCTGCTCAGACACCTTCCTCATTGGTTTGCTGATTGTTGTCAATGGGGGAACACTG
TCGGTGATCAGCTTTGTGGTCCTCTTAGCATCCTATGGAGTCATCTTGTTCCATCTGAGA
ACTCAGAGTGCTGAGGGACGGCGCAAAGCACTGTCCACCTGTGGATCCCATGTCACTGTG
GTTATATTGTTCTTTGGTCCATGTGTCTTCATCTATTTGAGGCCTTCTGATACCCTACCT
GTAGACAAGATGATAGCTGTGTTCTACACAGTGATAACTCCCCTGCTCAATCCTCTCATC
TACTCCCTGAGAAATGCAGAAGTGAAGAAAGCCATGAAGAGTCTATGGTTCAGGACAATG
AAAGTAGATGAGAAA


Conceptual translation

MNSSYHFRLYHPPCSLMADIHNVTEFIFLGLSSNQEVQKVCFVIFLLLYMAIVLGNLLMV
VTVVASRSLGSPMYFFLGYLSFVEICYSSTTAPKLILDLLAEKKSISVWGCMTQLFFMHF
FGGTEIFLLTMMAYDRYVAICKPLHYTSIMNQSVCAVLMGTAWIGGFVHSFAQILLIFPL
PFCGPNIIDHYFCDLLPVLKLACSDTFLIGLLIVVNGGTLSVISFVVLLASYGVILFHLR
TQSAEGRRKALSTCGSHVTVVILFFGPCVFIYLRPSDTLPVDKMIAVFYTVITPLLNPLI
YSLRNAEVKKAMKSLWFRTMKVDEK