Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51a39 Olfactory Receptor

Gene Symbol Or51a39
Organism Mouse
Family 51
Subfamily a
Pseudo No
Location chr7:102713458-102714411 (-)
Aliases Olfr33, MGC123818, MGC123819, MOR11-2, MTPCR33, ORL18, MGC123818, MGC123819, MOR11-2, MTPCR33, ORL18

Sequence information


Nucleotide sequence

ATGATCTCCTCAAAGGCTTTTGTCAATATCACCTTCTTCCAGCCACAATCTTTCCTGATG
ACTGGCATACCAGGACTAGAGTTTGCTCATGGCTGGATCTCCATCCCATTCTCTTCCATG
TACACTGTGGCACTCACTGGAAACTGCCTCATCCTCCTGGCTGTGAGGAGGACCCATAGC
CTACACCAGCCCATGTACTACTTTCTGTCCATGCTAGCCCTAAGTGATGTGGGTCTCAGC
TTGTCCACATTGCCTTCCACCCTGGCTGTGCTCTGGTTTGACTATCGTTTCATCGACTTC
AATGCCTGTCTGATCCAAATGTTCTTTCTTCATTTCTTCTCTGTGGTAGAGTCCTCAGTC
CTCTTGGCCATGTCATTTGACCGCTTTGTGGCTATCTCCAACCCTCTGCGCTATGCATCT
GTCCTCACTAACAATGTCATCATCAGGATTGGGGTGGCCATTACAACCCGAGCTACTTTG
TCCCTCTTACCATTGCCCTTCTTGCTGAAGAGGCTGAACTACTGCCCTGGCAAGATCCTC
CTGTCTCACTCATTCTGTTTCCATGCTGATGTCATGAAGCTGGCCTGTGCTGACATTACT
GTCAACATCCTATATGGACTCTATGTGGTTCTGTCCACAGTGGGTATAGACTCCTTGCTT
ATTGTCATGTCCTATTCCTTGATTCTTCACACAGTCATGGGGCTAGCCTCTCCCAGGGAG
CGTGTCCGGACCCTCAACACATGTGTTTCCCATATCTTGGCTGTCCTGGTCTTCTACATT
CCAGTCATAGGTGTGTCCATGATCCATCGTTTTGGAAAGCACCTGCCTCACATTGTTCAT
GCCCTGGTTGCGTATGTGTACCTTGTGGTGCCTCCTGTGCTCAACCCCATCATCTACAGT
GTCAAGTCCAAACCCATCAGGGGAGCCATGTTCAGAGTGCTAAGTAGGAAAGGC


Conceptual translation

MISSKAFVNITFFQPQSFLMTGIPGLEFAHGWISIPFSSMYTVALTGNCLILLAVRRTHS
LHQPMYYFLSMLALSDVGLSLSTLPSTLAVLWFDYRFIDFNACLIQMFFLHFFSVVESSV
LLAMSFDRFVAISNPLRYASVLTNNVIIRIGVAITTRATLSLLPLPFLLKRLNYCPGKIL
LSHSFCFHADVMKLACADITVNILYGLYVVLSTVGIDSLLIVMSYSLILHTVMGLASPRE
RVRTLNTCVSHILAVLVFYIPVIGVSMIHRFGKHLPHIVHALVAYVYLVVPPVLNPIIYS
VKSKPIRGAMFRVLSRKG