Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51a7 Olfactory Receptor

Gene Symbol Or51a7
Organism Mouse
Family 51
Subfamily a
Pseudo No
Location chr7:102965102-102966037 (+)
Aliases Olfr576, MGC129202, MOR8-5, Olfr576-ps1, MGC129202, MOR8-5, Olfr576-ps1

Sequence information


Nucleotide sequence

ATGTCTGTTTTCAACAACTCCGAGGTCATGTATTTTCTTCTAATTGGGATACCAGGACTG
GAATATGCCCACGAGTGGATCTCCATCCCTATCTTCCTCATGTACCTTATTGCCATCATG
GGTAACTGCATTATCATTTTTGTCATCAAGACAGAACCCTCTCTTCACGAGCCCATGTAC
TATTTCCTTACCATGTTGGCTGTCTCTGATATGGGCTTGTCCTTCTCTTCTCTTCCTACC
ATGCTTAAAATCTTCTTTTTCAATGCCATGGCAATCTCACCCAATGCCTGTTTTGCCCAA
GAGTTCTTTATCCATGGCTTCACTGTCATGGAGTCCTCTGTGCTTCTGATTATGTCTTTG
GACCGCTTTCTTGCCATTCACAACCCTTTAAGATACAGTTCTATCCTCAATGGCCGCAGA
GTTGCTAAAATAGGGCTAATTTTAGCCTTCAGGAGCACAGTTTTGGTGCTTCCATTCCCT
TTCACACTAAGGAAACTGAAATACTGTCACAAGAATCTCCTCTCTCACTCATACTGCCTT
CATCAAGATGTCATGAAACTGGCCTGCTCTGATAACAAGATCAATTTCATCTATGGCTTC
TTTGTGGCTCTCTGTACCATGCTGGACTTTGCCTTGATTCTTATGTCTTATGTGCTGATC
TTGAAGACAGTTCTCAGTATTGCATCTCTAGCAGAAAGGCTTAAGGCTCTAAATACCTGT
GTCTCCCACATCTGTGCTGTGCTCATCTTCTATGTGCCCATCATCACCCTGGCTGCCATA
CATCGCTTTGCCAAACACAAAAGTCCCCTACTTGTAATCCTTATTGCAGATATGTTCTTG
TTGGTGCCACCCCTGATGAACCCCATTGTGTACTGTATAAAGACTCGGCAAATCCGGGAG
AAGGTCTTGGGAAAGTTGGTTAACCTATGTGTGAGA


Conceptual translation

MSVFNNSEVMYFLLIGIPGLEYAHEWISIPIFLMYLIAIMGNCIIIFVIKTEPSLHEPMY
YFLTMLAVSDMGLSFSSLPTMLKIFFFNAMAISPNACFAQEFFIHGFTVMESSVLLIMSL
DRFLAIHNPLRYSSILNGRRVAKIGLILAFRSTVLVLPFPFTLRKLKYCHKNLLSHSYCL
HQDVMKLACSDNKINFIYGFFVALCTMLDFALILMSYVLILKTVLSIASLAERLKALNTC
VSHICAVLIFYVPIITLAAIHRFAKHKSPLLVILIADMFLLVPPLMNPIVYCIKTRQIRE
KVLGKLVNLCVR