Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51b6 Olfactory Receptor

Gene Symbol Or51b6
Organism Mouse
Family 51
Subfamily b
Pseudo No
Location chr7:103906441-103907385 (+)
Aliases Olfr65, 5'[b]3, 5'beta3, MOR1-1, MOR1-2, ORL670, Olfr, 5'[b]3, 5'beta3, MOR1-1, MOR1-2, ORL670, Olfr

Sequence information


Nucleotide sequence

ATGCCTTCAATGTGGCTCAACATTTCCTCTTCCCCATTCCTGCTCACAGGCTTCCCAGGT
CTGGAGAAAGCCCATCACCTGATCTCCCTCCCATTACTGATGGCCTATATCTCCATATTA
CTTGGCAACGGCACCCTCCTTTTCCTCATTAAGGATGACCATAACCTCCATGAGCCCATG
TATTATTTCTTAGGTATGTTGGCAGCTACGGATCTTGGCGTAACATTGACCACCATGCCC
ACAGTGCTGAGTGTACTATGGTTAAATCACAGGGAAATTGGCCATGGAGCCTGCTTCTCT
CAGGCCTATTTTATCCACACTCTCTCTATTGTGGAGTCGGGGGTCTTGCTTGCCATGGCC
TATGACCGTTTCATTGCCATTCGCAACCCACTAAGGTATACCACCATCCTTACAGATACT
AAGGTAATAAAGATTGGCATAGGCGTAGTGATGAGGGCTGGTCTGTCAATCATGCCAATA
ATCATTCGCCTGCATTGGTTTCCCTATTGTCGCTCCCATGTACTCTCCCATGCTTTCTGT
CTACACCAAGATGTCATCAAGCTAGCCTGCGCTGACATCACATTCAATCGTCTCTATCCT
GTTGTGGTTGTATTTGCAATGGTCTTGCTAGATTTCCTGATCATCTTCTTCTCCTACGTT
TTGATTCTCAAGACTGTCATGGGCATTGCTTCTACAGATGAGCGGGCCAAGGCTCTCAAC
ACATGTGTCTCCCACATCTGTTGCATCTTGGTCTTCTATGTCACTGTGGTTGGTCTGACG
TTTATTCACAGGTTTGGAAAGAATGTTCCTCATGTCGTCCACATCACAATGAGCTACGTC
TACTTTCTTTTCCCCCCTTTTATGAACCCTGTCATCTATAGCATTAAGACCAAACAGATT
CAGAGTGGTTTGCTTCGCTTATTCTCCCTGCCTTGTTCTAAAACA


Conceptual translation

MPSMWLNISSSPFLLTGFPGLEKAHHLISLPLLMAYISILLGNGTLLFLIKDDHNLHEPM
YYFLGMLAATDLGVTLTTMPTVLSVLWLNHREIGHGACFSQAYFIHTLSIVESGVLLAMA
YDRFIAIRNPLRYTTILTDTKVIKIGIGVVMRAGLSIMPIIIRLHWFPYCRSHVLSHAFC
LHQDVIKLACADITFNRLYPVVVVFAMVLLDFLIIFFSYVLILKTVMGIASTDERAKALN
TCVSHICCILVFYVTVVGLTFIHRFGKNVPHVVHITMSYVYFLFPPFMNPVIYSIKTKQI
QSGLLRLFSLPCSKT