Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51c4 Olfactory Receptor

Gene Symbol Or51c4
Organism Mouse
Family 51
Subfamily c
Pseudo No
Location chr7:102,803,000-102,804,000 (+)
Aliases Olfr564

Sequence information


Nucleotide sequence

MSTFQNTTASSIIFLLTGVPGLEAFHTWISIPFCFLYATALSGNSLILFVIITQPSLHEP
MCYFLSMLSTTDLGLSISTLATMLGIFWFNAREISFNACLSQMFFIQLFTVMESSVLLAM
AFDRYVAISNPLRYASVLTDLKIAQIGVAIVTRGTLILTPMVVLLKRLSYCSSHVLHHSY
CFHPDVMKLSCTDTRINSAVGLTALISTAGVDSVFIILSYVLIIRTVLSIASPEERKKAF
STCISHIGAVAVFYIPLISLSFVHRFGKRAPPYVHTLIANAYLLIPPVMNPIIYSVKTKK
IRKAVLKVFHSSMTKS


Conceptual translation

MSTFQNTTASSIIFLLTGVPGLEAFHTWISIPFCFLYATALSGNSLILFVIITQPSLHEP
MCYFLSMLSTTDLGLSISTLATMLGIFWFNAREISFNACLSQMFFIQLFTVMESSVLLAM
AFDRYVAISNPLRYASVLTDLKIAQIGVAIVTRGTLILTPMVVLLKRLSYCSSHVLHHSY
CFHPDVMKLSCTDTRINSAVGLTALISTAGVDSVFIILSYVLIIRTVLSIASPEERKKAF
STCISHIGAVAVFYIPLISLSFVHRFGKRAPPYVHTLIANAYLLIPPVMNPIIYSVKTKK
IRKAVLKVFHSSMTKS