Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51g1 Olfactory Receptor

Gene Symbol Or51g1
Organism Mouse
Family 51
Subfamily g
Pseudo No
Location chr7:102984224-102985162 (-)
Aliases Olfr578, MOR7-1, MOR7-1

Sequence information


Nucleotide sequence

ATGGCCATCCTTTACAACAGCAGCCTCCAAAAAGCCACTTTCTTCCTGACAGGCTTTCAA
GGTCTGGAAGAATTCCATGGCTGGATCTCCATTCCCTTCTGCTCCATCTACTTAATAGTC
ATTTTAGGAAACCTCACTATTCTCCATGTCATCCGGACTGATGCCACTCTCCATGAACCT
ATGTACTATTTCTTGGCTATGCTGGCCCTCACAGACTTGGGACTCTGCCTCTCCACACTG
CCCACTGTGCTGGGAATCTTCTGGTTTGATGCCAGAGAGATTGGTATTCCTGCCTGCTTT
ACTCAGCTATTCTTCATCCACACCTTGTCTTTAGTGGAGTCATCGGTTCTACTGTCTATG
TCCTTCGACCGCTATGTAGCAATTTGCAACCCACTGCGTTATTCTACCATCCTGACGCCC
AGAAGGATTGTGAAGATGGGGCTGAGCTCAGTACTCAGAAGTGCACTCCTCATTCTCCCA
TTACCTTTCCTCCTTAAACGCTTCCATTATTGCCGATCCCACGTGTTAGCCCATGCCTAT
TGTCTACATCTGGAGATCATGAAACTAGCCTGCTCCAGCATCATTGTCAATCATATCTAT
GGGCTCTTTGTTGTGGCCTGCACTGTGGGTGTAGACTCCCTGCTTATATTCCTCTCATAC
ACCCTCATCCTCCATGCTGTACTAGGCAAAGCCTCCCGTCAGGAGCGCCTCCGTGCTCTC
AATACCTGTATCTCTCATATCTGTGCAGTACTGCTTTTCTACATCCCCATGATTGGCTTA
TCCCTTGTGCATCGCTTTGGTGAGCACCTTCCCCGCATTGTACATCTTCTGATGTCATAT
GTGTATCTATTAGTACCACCCCTCATGAACCCCATTGTCTACAGCATCAAGACCAAGCAA
ATACGACAGCGTATCATCAAGAAGTTTGAGTTTATAAAG


Conceptual translation

MAILYNSSLQKATFFLTGFQGLEEFHGWISIPFCSIYLIVILGNLTILHVIRTDATLHEP
MYYFLAMLALTDLGLCLSTLPTVLGIFWFDAREIGIPACFTQLFFIHTLSLVESSVLLSM
SFDRYVAICNPLRYSTILTPRRIVKMGLSSVLRSALLILPLPFLLKRFHYCRSHVLAHAY
CLHLEIMKLACSSIIVNHIYGLFVVACTVGVDSLLIFLSYTLILHAVLGKASRQERLRAL
NTCISHICAVLLFYIPMIGLSLVHRFGEHLPRIVHLLMSYVYLLVPPLMNPIVYSIKTKQ
IRQRIIKKFEFIK