Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51g2 Olfactory Receptor

Gene Symbol Or51g2
Organism Mouse
Family 51
Subfamily g
Pseudo No
Location chr7:102973055-102973990 (-)
Aliases Olfr577, MOR7-2, MOR7-2

Sequence information


Nucleotide sequence

ATGACTCCAGGACCCCTAGGAAATGGAAGCATGTCTTCTACCTTCTTGCTGAGTGGCATC
CCTGGGCTGGAGCACATGCATATCTGGATCTCCCTTCCACTCTGTCTCATGTACCTGGTT
TCCATCCTGGGTAACTGCACAATCCTTTTTATAATTAAGACAGAGCCCTCACTCCATGAG
CCCATGTACCTCTTCCTGTCCATGCTCGCTCTGACTGACCTTGGTCTCTCTCTTTGTACC
CTCCCTACAGTGCTAGGCATCTTTTGGGTGGGAGCACGAGACATTAGCCATGATGCTTGC
TTTACCCAGCTCTTTTTCATCCACTGCTTGTCCTTCTTAGAATCCTCTGTGCTTCTCTCT
ATGGCCTTTGATCGCTTTGTGGCTATCTGTCGTCCTTTGCACTATGCTTCCATCCTCACC
CACACAGTGATTGTCAGAATAGGTCTGGCCTCTCTGGGCCGTAGTGTTGCACTCATTTTC
CCATTGCCTTTCATGCTCAAACGGTTCCCTTACTGTGGCTCCCTAGTTCTCTCACATTCC
TATTGTCTCCATCAAGAAGTGATGAAACTGGCCTGTGCAGACATCAAGGCAAACAGCATT
TATGGCATGTTCGTCATTGTTTCTACAGTGGGAGTGGACTCTTTGCTCATCCTCTTCTCC
TATGCACTTATTCTGCGCACCGTATTGTCCATTGCCTCAAGGGCTGAAAGACTCAAAGCT
CTCAATACATGCGTTTCACACATCTCTGCTGTGCTTCTGTTCTATACTCCCATGATAGGA
TTGTCTGTAATCCACCGCTTTGGGAAACAGGCCCCCCATCTAGTTCAGGTGGTCATGGGC
TTTGTGTATCTCCTCTTCCCTCCTGTGATGAACCCTATTGTCTATAGTGTCAAGACCAAA
CAGATACGGGATAGGGTAGCCCATGCCTTTTGCAAC


Conceptual translation

MTPGPLGNGSMSSTFLLSGIPGLEHMHIWISLPLCLMYLVSILGNCTILFIIKTEPSLHE
PMYLFLSMLALTDLGLSLCTLPTVLGIFWVGARDISHDACFTQLFFIHCLSFLESSVLLS
MAFDRFVAICRPLHYASILTHTVIVRIGLASLGRSVALIFPLPFMLKRFPYCGSLVLSHS
YCLHQEVMKLACADIKANSIYGMFVIVSTVGVDSLLILFSYALILRTVLSIASRAERLKA
LNTCVSHISAVLLFYTPMIGLSVIHRFGKQAPHLVQVVMGFVYLLFPPVMNPIVYSVKTK
QIRDRVAHAFCN