Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51i2 Olfactory Receptor

Gene Symbol Or51i2
Organism Mouse
Family 51
Subfamily i
Pseudo No
Location chr7:104039798-104040733 (+)
Aliases Olfr641, MOR13-3, MOR13-3

Sequence information


Nucleotide sequence

ATGGCGCTGTTCAATGTCACTCACCCTGCCTCCTTTCTCCTGACTGGTATCCCTGGTCTG
GAGAGCCTCCACCCCTGGCTGGCAGGACCCCTTTGTGTGATGTATGCCGTGGCCCTCGGG
GCAAATACTGTGATTCTGCAGGCTGTGAGAGTGGAGCCCATCCTCCATGCTCCCATGTAC
TATTTCCTGTCCATGTTGTCTTTCAGTGATGTGGCCATGTCAATGGCCACACTGCCCACC
GTGCTGAGAACCTTCTGCTTTGATGCCCGCAGCATTGCTTTTGACGCCTGTCTAGTCCAG
ATGTTCCTCATTCATTCTTTCTCGATGATGGAGTCAGGGATTCTGCTGGCTATGAGTTTT
GACCGCTATGTGGCCATATGCAATCCCTTGCATTATGCCACTGTCCTCACCAATGAATTC
ATTGCTGGGATGGGCTTAGCTGTGACTGCTCGAAGCTTCATCACCCTTTTCCCTCTGCCC
TTCCTCATCAAAAGGCTACCTATCTGCAAATCCAATGTTCTTTCCCACTCCTACTGCCTG
CACCCAGACATGATGAAGCTTGCCTGTGCTGACATCACCATCAACAGTATTTATGGACTC
TTTGTTCTTGTGTCTACCTTTGGCATGGACCTGCTTTTTATTTTCCTCTCCTATGTGCTC
ATTCTGCGTTCTGTTATGGCCATTGCTTCTCATGAGGAACGCCTTAAAGCTCTCAACACA
TGTGTATCACATATCTTGGCTGTGCTTGCATTTTATGTGCCAATGATAGGGGTCTCTACA
GTTCACCGTTTTGGGAAGCATGCCCCACGATACATACATGTCCTCATGTCCAATGTCTAC
CTCTTTGTGCCTCCTGTTCTCAACCCTCTCATTTACAGTGCCAAGACAAAGGAGATCCGC
CGTGCCATATTCCGCATGTTTCGCCGTATCAAACTG


Conceptual translation

MALFNVTHPASFLLTGIPGLESLHPWLAGPLCVMYAVALGANTVILQAVRVEPILHAPMY
YFLSMLSFSDVAMSMATLPTVLRTFCFDARSIAFDACLVQMFLIHSFSMMESGILLAMSF
DRYVAICNPLHYATVLTNEFIAGMGLAVTARSFITLFPLPFLIKRLPICKSNVLSHSYCL
HPDMMKLACADITINSIYGLFVLVSTFGMDLLFIFLSYVLILRSVMAIASHEERLKALNT
CVSHILAVLAFYVPMIGVSTVHRFGKHAPRYIHVLMSNVYLFVPPVLNPLIYSAKTKEIR
RAIFRMFRRIKL