Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51l1-ps Olfactory Receptor

Gene Symbol Or51l1-ps
Organism Mouse
Family 51
Subfamily l
Pseudo Yes
Location chr7:103134376-103135302 (+)
Aliases Olfr587-ps1, MOR7-3_p, MOR7-3_p

Sequence information


Nucleotide sequence

ATGCTTGCCTGGAATAGCAGTGATGTTACAGAGCCCATATTTATCCTGAAGGGTTTTCCA
GGACTGGAGTATGTTCATTCTTGGCTCTCAATACCTTTCTGTCTTGCTTATTTAGTAGCC
TTCATTGGTAATGTAACCATTCTCTCTGTTATTTGGGTAGAGTCCTCACTACATCAGCCC
ATGTACTACTTCCTTTCCATCTTGGCACTGACTGACCTAGGTATGTCTATGTCTACACTT
CCCACAATGCTGACTGTGCTGTGGTTGGATGTCCGAGAAATACAGGCTAGTGCTTGCTAG
GCTCAGTTGTTCTTCATCCACACATTCACATTTCTTGAGTCCTCAGTGCTTCTGGCTATG
GCCTTTGACCGCTTCATAGCAATCTGCCGTCCACTGCACTATTCTACCATCCTCACCAAC
AGTGTGATTGGCAAGATTGGTATGGCCTGCTTGCTACGGAGCATGGGAGTTGTTCTGCCT
ACACCTTTGCTACTGAGACGCTATCACTATTGCCGGGTCAATGCCCTCTCCCATGCCTTC
TGCTTACACCAAGATGTTCTGAGGCTGTCCTGCTCTGATGCCAGGATCAACAGCGTCTAT
GGACTATGTGTAGTTATTGCTACACTAGGTGTGGATTCAGTCTTTATACTTATTTCTTAC
GTTCTTATTCTGAATGCAGTGTTGAGTATTGCATCCCGTGAAGAGCGACTAAAAGCTCTG
AATACCTGTGTTTCCCATGTCTGTGTGGTACTCATTTTCTTTGTACCAGTAATTGGGGTG
TCAATGGTTCATCGCTTTGGGAAACATCTCTCTCCCATAGTCCACATCCTCATGGCTGAC
ATCTACCTGCTTCTACCCCCAGTGCTGAACCCAGTTGTCTACAGTGTGAGGACAAAACAG
ATTCGTCTAGGAATTCTCCGCAAGTTT


Conceptual translation

MLAWNSSDVTEPIFILKGFPGLEYVHSWLSIPFCLAYLVAFIGNVTILSVIWVESSLHQP
MYYFLSILALTDLGMSMSTLPTMLTVLWLDVREIQASAC*AQLFFIHTFTFLESSVLLAM
AFDRFIAICRPLHYSTILTNSVIGKIGMACLLRSMGVVLPTPLLLRRYHYCRVNALSHAF
CLHQDVLRLSCSDARINSVYGLCVVIATLGVDSVFILISYVLILNAVLSIASREERLKAL
NTCVSHVCVVLIFFVPVIGVSMVHRFGKHLSPIVHILMADIYLLLPPVLNPVVYSVRTKQ
IRLGILRKF