Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or51q1b-ps Olfactory Receptor

Gene Symbol Or51q1b-ps
Organism Mouse
Family 51
Subfamily q
Pseudo Yes
Location chr11:108687077-108688017 (-)
Aliases Olfr1397-ps1, MOR5-3, MOR5-3

Sequence information


Nucleotide sequence

ATGTCAGAAATAACTAACTTCACTCATGATCCTTTCTACTTCATCCTCACCGGCATCCCA
GGATTTGAGGATATCCATCTCTGGATCTCCATCCCCTTCTGTCTCTACACCATCTCCATC
ATGGGCAACACCACCATCCTCACTGTCATCTGCACAGAGCCATCTCTTCACCAGCTCATT
ACCTCTTCCTCTCCATGCTGGCCCTCACTGACCTGGGTCTCGCTCTCACCACACTCCCTA
CCATCATGCACCTCCTTTGGTTCAACATTCGGGAAATCAGCTTTGAAGCCTGCTTTGCAC
AGTTCTTCTTCCTCCATGGGTTCTCATTCATGGAATCATCTGTTCTATTGGCCATGTCCT
TTGACCGTTACGTGGCCATCTGCTGCCCACTCCACTATGCCTCCATCCTCACCAGTGAGG
TCATTGCTAGAATAGGGTTGGCCATCATTTGCCGCTGTGTCTTGGCTGTTCTTCCCTTCC
TTTTCCTGCTCAAGCGCCTGTCCTTCTGCCATTCCCACCTTCTTTCACACTCCTACTGCC
TCCACCAGGATATGATTCACCTGGTCTGCACTGACATCAGGGTCAACAGCTGGTATGCAT
TTGCTCTGGTCCTGCTCATTATTATATTGAACCCTCTGCTCATTGTACTCTCCTATGCAG
TTATCCTGAAGAGTGTCTTGAACACAGCCACTTGGACTGAACGACTTCGGGCTCTGAACA
ACTGTCTGTCCCACATGCTGGCTGTTCTGGTTCTCTATGTCCCTATGGTTGGTGTGTCTA
TGACTCACCGCTTTGCCAAGCATGCCTCTCCACTGGTCCATGTTCTCATGGCCAATATCT
ACCTGCTAGCACCTCCTGTGATGTACCCCATCATTTACAGTGTAAAGACCAAGCAGATCC
GTCAAGGAATTACTCGCCTCCTCTTGCAGAGAAAGGTGCAC


Conceptual translation

MSEITNFTHDPFYFILTGIPGFEDIHLWISIPFCLYTISIMGNTTILTVICTEPSLHQ/
HYLFLSMLALTDLGLALTTLPTIMHLLWFNIREISFEACFAQFFFLHGFSFMESSVLLAM
SFDRYVAICCPLHYASILTSEVIARIGLAIICRCVLAVLPFLFLLKRLSFCHSHLLSHSY
CLHQDMIHLVCTDIRVNSWYAFALVLLIIILNPLLIVLSYAVILKSVLNTATWTERLRAL
NNCLSHMLAVLVLYVPMVGVSMTHRFAKHASPLVHVLMANIYLLAPPVMYPIIYSVKTKQ
IRQGITRLLLQRKVH