Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52a20 Olfactory Receptor

Gene Symbol Or52a20
Organism Mouse
Family 52
Subfamily a
Pseudo No
Location chr7:103716596-103717543 (+)
Aliases Olfr243, Olfr243-ps1, Olfr243-ps1

Sequence information


Nucleotide sequence

ATGCCCCATCTCAACAGCACCATCTTCAGGCCTTCAGTGCTGACTCTGACTGGGATTCCT
GGCTTGGAGTCTGTGCAGTTCTGGATTGGGATTCCTTTCTGTATCATGTACATCATTGCA
CTTTTGGGGAATTCTCTACTCCTAGTTGTCATCAAAGTTGAGCGAAGCCTCCATGAACCC
ATGTACCTCTTCCTAGCAATGCTTGGAGCAACAGACATTGCCATCAGTACTTGCATCTTA
CCAAAAATGTTAGGAATATTCTGGTTTCACCTTCCAACCATATACTTTGATGTCTGCCTC
TTACAGATGTGGCTGATTCACACATTCCAATGTATTGAGTCAGGCATCTTGTTTGCCATG
GCAATGGACCGTTATGTGGCAATCTGTGATCCTCTAAGACATGCATCCATCTTTACCCAG
CGACTCCTCACTCAAATAGGAGTAGGAGTCACACTCAGAGCAGCCCTGTTTGTAGCTCCA
TGTCTCATTCTCATCAAATGCAGGTTGAAATTCTACTGGACCACTGTTGTTTCCCATTCA
TACTGTGAGCACATGGCCATTGTGAAGCTGGCAGCAGAAGATGTTCATGTCAACAAGATC
TATGGTCTGTTTGTGGCCTTCAGTATTCTTGGACTAGACATAATTTTCATCACACTTTCC
TACATTAGAATATTTATAACGGTCTTCAAGCTCCCTCAAAAGGAAGCAAGACTCAAAGCC
TTTAATACATGTATTGCCCATATTTGTGTCTTCTTGGAGTTTTACCTTCTGGCCTTCTTC
TCCTTCTTTACACATAGGTTTGGCTACCATGTTCCATCTTACATTCACATTCTCCTGTCC
AACCTTTACCTACTTGTCCCACCTTTGCTCAATCCTATTGTTTATGGTGTGAAGACCAAA
CAGATTCGAGATCAAGTGTCCAAAATTTTGTATTGTAATTATTCTTAT


Conceptual translation

MPHLNSTIFRPSVLTLTGIPGLESVQFWIGIPFCIMYIIALLGNSLLLVVIKVERSLHEP
MYLFLAMLGATDIAISTCILPKMLGIFWFHLPTIYFDVCLLQMWLIHTFQCIESGILFAM
AMDRYVAICDPLRHASIFTQRLLTQIGVGVTLRAALFVAPCLILIKCRLKFYWTTVVSHS
YCEHMAIVKLAAEDVHVNKIYGLFVAFSILGLDIIFITLSYIRIFITVFKLPQKEARLKA
FNTCIAHICVFLEFYLLAFFSFFTHRFGYHVPSYIHILLSNLYLLVPPLLNPIVYGVKTK
QIRDQVSKILYCNYSY