Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52a5 Olfactory Receptor

Gene Symbol Or52a5
Organism Mouse
Family 52
Subfamily a
Pseudo No
Location chr7:103777399-103778343 (-)
Aliases Olfr68, 3'[b]2, 3'beta2, MOR22-3, 3'[b]2, 3'beta2, MOR22-3

Sequence information


Nucleotide sequence

ATGATCAAGTTCAATGGCTCAGTCTTCATGCCTTCTGTGTTAACACTAGTGGGGATCCCT
GGCCTGGAGTCAGTGCAGTGCTGGATTGGAATTCCATTCTGTGTCATGTACATCATTGCT
ATGATTGGGAACTCCCTAATTTTAGTTATAATCAAAAGTGAAAAGAGCCTCCACATACCC
ATGTACATTTTCTTGGCTATTTTGGCAGTCACAGACATTGCCCTTAGCACATGCATTCTT
CCCAAAATGTTGGGCATCTTCTGGTTTCACATGCCACAGATTTTCTTTGATGCCTGCCTG
CTGCAGATGGAACTCATCCACTCATTCCAGGCCACAGAATCAGGCATCCTCCTGGCCATG
GCTCTGGATCGCTATGTGGCTATCTGCAACCCCCTCAGACATGCTACTATCTTCTCTCCA
CAACTCACCACTTGCCTTGGAGCTGGTGCATTACTCAGGGCTTTCATTCTTGTATCCCCA
TCCATACTACTCATCAAATGTCGCCTTAAGTACTTTCAAACTACCATTATCTCCCACTCG
TACTGTGAACACATGGCCATTGTGAAACTGGCAGCTCAAGATATCAGAATCAACAAGATA
TGTGGCCTCCTTGTTGCCTTTGCCATCTTAGGGTTTGACATAGTCTTCATTACCTTCTCC
TATGTGCGAATCTTCATCACAGTCTTCCAGCTGCCCCAGAAGGAGGCTCGATTCAAAGCC
TTCAATACCTGCATTGCTCACATCTGTGTCTTCCTGCAGTTCTACCTTCTGGCCTTCTTC
TCTTTCTTCACACACAGGTTTGGGGCTCACATACCCCCCTATGTGCACATCCTCCTGTCA
GACCTTTACCTGTTAGTCCCACCTTTTCTGAACCCCATTGTTTATGGTGTTAAAACTAAA
CAAATCCGTGACCAAGTCCTGAAAATGCTATTCTCCAAGAAACAT


Conceptual translation

MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIP
MYIFLAILAVTDIALSTCILPKMLGIFWFHMPQIFFDACLLQMELIHSFQATESGILLAM
ALDRYVAICNPLRHATIFSPQLTTCLGAGALLRAFILVSPSILLIKCRLKYFQTTIISHS
YCEHMAIVKLAAQDIRINKICGLLVAFAILGFDIVFITFSYVRIFITVFQLPQKEARFKA
FNTCIAHICVFLQFYLLAFFSFFTHRFGAHIPPYVHILLSDLYLLVPPFLNPIVYGVKTK
QIRDQVLKMLFSKKH