Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52a5b Olfactory Receptor

Gene Symbol Or52a5b
Organism Mouse
Family 52
Subfamily a
Pseudo No
Location chr7:103767448-103768395 (-)
Aliases Olfr69, 3'[b]3, 3'beta3, MOR22-2, 3'[b]3, 3'beta3, MOR22-2

Sequence information


Nucleotide sequence

ATGATCAAGTTCAATGGCTCAGTCTTCATGCCTTCTGTTTTAACACTAGTGGGGATCCCT
GGCCTGGAATCAGTGCAGTGCTGGATTGGAATTCCATTCTGTGTCATGTACATCATTGCT
ATGATTGGGAACTCCCTAATTTTAGTTATAATCAAAAGTGAAAAGAGCCTCCACATACCC
ATGTATATTTTCTTGGCTATTTTGGCAGTCACAGACATTGCCCTTAGCACATGCATTCTT
CCCAAAATGTTGGGCATCTTCTGGTTTCACATGCCACAGATTTCCTTTGATGCCTGCCTG
CTGCAGATGGAACTCATCCACTCATTCCAGGCCACAGAATCAGGCATCCTCCTGGCCATG
GCTCTGGATCGCTATGTGGCTATCTGCAACCCCCTCAGACATGCTACTATCTTCTCTCCA
CAACTCACCACTTGCCTTGGAGCTGGTGCATTACTGAGGTCTCTCATTACCACATTTCCA
TTGATATTGCTCATCAAATGTCGCCTTAAGTACTTTCGAACTACCATTATCTCCCACTCG
TACTGTGAACACATGGCCATTGTGAAATTGGCAGCTCAAGATATCAGAATCAACAAGATA
TGTGGCCTCCTTGTTGCCTTTGCCATCTTAGGGTTTGACATAGTCTTCATTACCTTCTCC
TATGTGCGAATCTTCATCACGGTCTTCCAGCTGCCCCAGAAGGAGGCTCGATTCAAAGCC
TTCAATACCTGCATTGCTCACATCTGTGTCTTCCTGCAGTTCTACCTTCTGGCCTTCTTC
TCTTTCTTCACACACAGGTTTGGGGCTCACATACCCCCCTATGTGCACATCCTCCTGTCA
GACCTTTACCTGTTAGTCCCACCTTTTCTGAACCCCATTGTTTATGGTGTTAAAACTAAA
CAAATCCGTGACCAAGTCCTGAAAATGCTTTTCTCCAAGAAACCCCTG


Conceptual translation

MIKFNGSVFMPSVLTLVGIPGLESVQCWIGIPFCVMYIIAMIGNSLILVIIKSEKSLHIP
MYIFLAILAVTDIALSTCILPKMLGIFWFHMPQISFDACLLQMELIHSFQATESGILLAM
ALDRYVAICNPLRHATIFSPQLTTCLGAGALLRSLITTFPLILLIKCRLKYFRTTIISHS
YCEHMAIVKLAAQDIRINKICGLLVAFAILGFDIVFITFSYVRIFITVFQLPQKEARFKA
FNTCIAHICVFLQFYLLAFFSFFTHRFGAHIPPYVHILLSDLYLLVPPFLNPIVYGVKTK
QIRDQVLKMLFSKKPL