Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52b6-ps Olfactory Receptor

Gene Symbol Or52b6-ps
Organism Mouse
Family 52
Subfamily b
Pseudo Yes
Location chr7:104,206,000-104,207,000 (+)
Aliases Olfr650-ps1

Sequence information


Nucleotide sequence

VAAVNSSDTRVTGCLLTGIPGLEHLQMWLSIPFCIMYIAALVGNSVLVCVILSQSSLHEP
MYIFLSMLASADVLLSTSTMPKTLANFWLGSSHISFDGCLTQMFFIHFLFVADSAVLLAM
AFDCYVAICSPLRYTTILTRQVMGKMAAAILTRSFIIMLPCIFLLKRLHYCRINVIEHTF
CEHMGIARLSCSDISINVWYGLTAALLSTGLDIILIAVSYVHIL*AVFRLSSQEARSKAL
STCGSHVCVILLFYIPALFSVFAYRFGGKHIPRYVHILLANLYVVIPPMLNPVIYGVRTK
QILEGAKQMFTNITKEFK


Conceptual translation

VAAVNSSDTRVTGCLLTGIPGLEHLQMWLSIPFCIMYIAALVGNSVLVCVILSQSSLHEP
MYIFLSMLASADVLLSTSTMPKTLANFWLGSSHISFDGCLTQMFFIHFLFVADSAVLLAM
AFDCYVAICSPLRYTTILTRQVMGKMAAAILTRSFIIMLPCIFLLKRLHYCRINVIEHTF
CEHMGIARLSCSDISINVWYGLTAALLSTGLDIILIAVSYVHIL*AVFRLSSQEARSKAL
STCGSHVCVILLFYIPALFSVFAYRFGGKHIPRYVHILLANLYVVIPPMLNPVIYGVRTK
QILEGAKQMFTNITKEFK