Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e3 Olfactory Receptor

Gene Symbol Or52e3
Organism Mouse
Family 52
Subfamily e
Pseudo No
Location chr7:103,220,000-103,221,000 (+)
Aliases Olfr594

Sequence information


Nucleotide sequence

MLLSNDTQFHPSSFLLLGIPGLESHHTWIGFPFCAVYLIALLGNFTILLVIKTESSLHQP
MFYFLAMLATIDLGLSTATIPKMLGIFWFSFRVILFGACLTQMFFIHNFTGMESAVLLAM
AYDRYVAICNPLRYSTILTNKAVFMIGLGVLVRSFLSVIPFVFLILRLPFCGNNVIPHTY
CEHMGLARLSCANIKVNIIYGLGAISILFFDIIAIALSYAQILRAVFRLPSREARIKSLS
TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YDRVKKIFLQK


Conceptual translation

MLLSNDTQFHPSSFLLLGIPGLESHHTWIGFPFCAVYLIALLGNFTILLVIKTESSLHQP
MFYFLAMLATIDLGLSTATIPKMLGIFWFSFRVILFGACLTQMFFIHNFTGMESAVLLAM
AYDRYVAICNPLRYSTILTNKAVFMIGLGVLVRSFLSVIPFVFLILRLPFCGNNVIPHTY
CEHMGLARLSCANIKVNIIYGLGAISILFFDIIAIALSYAQILRAVFRLPSREARIKSLS
TCGSHVCVILAFYTPALFSFMTHRFGRNVPRYIHILLANLYVVVPPMLNPVIYGVRTKQI
YDRVKKIFLQK