Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52e4 Olfactory Receptor

Gene Symbol Or52e4
Organism Mouse
Family 52
Subfamily e
Pseudo No
Location chr7:105056185-105057183 (+)
Aliases Olfr677, MOR32-11, MOR32-11

Sequence information


Nucleotide sequence

ATGGAAGCGCTTAATGAGAGGATAGTCTCCCTTAACAAGAATTCTCAGACATTTGCTTGG
AGAATGTCTTCTATCAATAGCACCCAGTTCCATCCCTCTTTCTTTATCCTGGTAGGGATT
CCAGGATTGGAAATTTTTCATATATGGATTGCTTTCCCATTCTGTCTTGTGTATCTGACT
TCCCTTGTGGGAAACATCACCATTCTCTTTGTGATCAAGACTGAACATAGCCTTCACCAG
CCCATGTTCTACTTTCTAGCCACATTGTCGATAATTGATCTGTGTCTATCCACATCTACT
ATCCCCAAAATGTTAGGCATCTTCTGGTTCAATCTCCGGGAGATCAGTTTCGGGGGCTGC
CTTGCTCAAATGTTCTTCATCCACGTGTTTACAGGCATGGAAACTGTTTTGCTAGTGGTC
ATGGCTTATGACCGCTTTGTTGCCATCTGCAAACCTCTCCAGTACACCACAATCCTCACC
AATAAAACCATCAGCCTTCTTCTCTCAGTTGTTATTGGAAGAAATTTAATTCTCGTGACT
CCGTTTGTGTTTCTCATTCTAAGACTGCCCTTTTGTGGTCACCACATCATGCCTCACACA
TACTGTGAGCACATGGGTCTGGCCCGATTAGCTTGTGCACCCATCAAGATCAACATCATC
TATGGACTCGTAGTGATTTCCCATATCCTTGTGGACATGATCCTGATTGCCTCTTCCTAT
GTGCTTATCCTTCGAGCTGTTTTCCGAATTCCCTCTCAAGATGCCCGATTGAAGGCGCTA
AACACTTGTGGTTCCCATGTCTGTATAATGCTGTGTTTTTACACACCAGCTCTGTTTTCT
TTCATGACTCACCGCTTTGGCCAAAACATTCCCCACTACATCCACATTCTTTTAGCTAAT
CTGTATGTAGTCATTCCACCTGCTCTGAACCCTGTCATTTATGGAGTCAGAACTAAGCAG
ATAAGAGAGAAAATTATAAAAATAGTTGTACAAAAAGAA


Conceptual translation

MEALNERIVSLNKNSQTFAWRMSSINSTQFHPSFFILVGIPGLEIFHIWIAFPFCLVYLT
SLVGNITILFVIKTEHSLHQPMFYFLATLSIIDLCLSTSTIPKMLGIFWFNLREISFGGC
LAQMFFIHVFTGMETVLLVVMAYDRFVAICKPLQYTTILTNKTISLLLSVVIGRNLILVT
PFVFLILRLPFCGHHIMPHTYCEHMGLARLACAPIKINIIYGLVVISHILVDMILIASSY
VLILRAVFRIPSQDARLKALNTCGSHVCIMLCFYTPALFSFMTHRFGQNIPHYIHILLAN
LYVVIPPALNPVIYGVRTKQIREKIIKIVVQKE