Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52h1 Olfactory Receptor

Gene Symbol Or52h1
Organism Mouse
Family 52
Subfamily h
Pseudo No
Location chr7:104,179,000-104,180,000 (-)
Aliases Olfr648

Sequence information


Nucleotide sequence

MITSNVSSYNPGPFLLVGIPGLEHFHVWIGIPFCVIYIIAVVGNCILLYLITVERSLHEP
MFFFLSMLAMTDLILSTDGVPKTLSIFWMGAREITFPGCLTQMFFLHYSFVLDSAILMAM
AFDRYVAICSPLRYATILTPKTIVKIAVGISFRSFCIILPVVFLLTRLPFCRTRIIPHTY
CEHIGVARLACADISINIWYGFCVPIMTVISDVVLIAVSYTLILCAVFRLPSRDARQKAL
GTCGSHVCVILMFYTPAFFSILAHRFGHNVSLTFHIMFANLYIVIPPAMNPIVYGVKTKQ
IREKVILLFSVKSIDG


Conceptual translation

MITSNVSSYNPGPFLLVGIPGLEHFHVWIGIPFCVIYIIAVVGNCILLYLITVERSLHEP
MFFFLSMLAMTDLILSTDGVPKTLSIFWMGAREITFPGCLTQMFFLHYSFVLDSAILMAM
AFDRYVAICSPLRYATILTPKTIVKIAVGISFRSFCIILPVVFLLTRLPFCRTRIIPHTY
CEHIGVARLACADISINIWYGFCVPIMTVISDVVLIAVSYTLILCAVFRLPSRDARQKAL
GTCGSHVCVILMFYTPAFFSILAHRFGHNVSLTFHIMFANLYIVIPPAMNPIVYGVKTKQ
IREKVILLFSVKSIDG