Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52i2 Olfactory Receptor

Gene Symbol Or52i2
Organism Mouse
Family 52
Subfamily i
Pseudo No
Location chr7:102669922-102670893 (+)
Aliases Olfr556, MOR41-1, MOR41-1

Sequence information


Nucleotide sequence

ATGCTGGGGCCATCCTACAACCACACAATGGAATCCCCTGGCACTTTCTTCCTCTTGGGC
ATCCCAGGGTTTCAGTCTTCTTATCTTTGGCTGGCCATCTCACTGAGTACCATGTATAGC
ATAGCTGTCTTAGGAAATATGCTCATTATCATTGTGATCTGCATGGATTCCACTCTACAA
GAGCCTATGTACTTCTTTCTATGTGTTCTGGCTGCTGTGGATATTGTTATGGCTTCTTCT
GTGGTACCTAAGATGGTGAGCATCTTCAGTTCAGGAGACAGCTCCATCAGCTTTAATGCC
TGTTTCACTCAGATGTACTTTGTCCATGCGGCCACTGCTGTGGAGACAGGTCTGCTACTG
GCCATGGCTTTTGATCGCTACGTGGCCATCTGCAAGCCCTTACATTACATGAGAATTCTC
ACCCGTCATGTGATGCTGGGAATTAGTGTGACTATCACCGTTAGAGCTGTTATTTTTATG
ACTCCTTTGAGTTGGATGTTGAGTCATTTGCCATTTTGTGCCTCCAATGTAGTTCCTCAT
TCCTATTGTGAACACATGGCTGTGGCCAAGTTAGCATGTGCTGACCCCATGCCCAGCAGT
CTCTACAGTTTGATTTTTTCCTCCATCATTGTGGGCTCAGATGTGGCCTTCATTTCAGCC
TCTTATTCTTTGATTCTCAAGGCAGTTTTTGGACTGTCCTCAAGGAATGCACAGTGGAAG
GCTTTGAGTACATGTGGCTCTCATGTTGGGGTCATGGCTCTGTACTATCTCCCTGGGATG
GCATCCATCTATGTGGCCTGGCTAGGGCAGGACCGAGTTCCACTGCACACTCAAGTGCTA
TTAGCTGACTTGTACCTGATCATCCCACCCACCTTAAACCCTATCATTTATGGTATTAGG
ACCAGACAAATCCGGGAGCGGATATGGAGTCTGCTGACACATTGCTTCTTTTCCCAGTGC
ACTCAAGGTTCA


Conceptual translation

MLGPSYNHTMESPGTFFLLGIPGFQSSYLWLAISLSTMYSIAVLGNMLIIIVICMDSTLQ
EPMYFFLCVLAAVDIVMASSVVPKMVSIFSSGDSSISFNACFTQMYFVHAATAVETGLLL
AMAFDRYVAICKPLHYMRILTRHVMLGISVTITVRAVIFMTPLSWMLSHLPFCASNVVPH
SYCEHMAVAKLACADPMPSSLYSLIFSSIIVGSDVAFISASYSLILKAVFGLSSRNAQWK
ALSTCGSHVGVMALYYLPGMASIYVAWLGQDRVPLHTQVLLADLYLIIPPTLNPIIYGIR
TRQIRERIWSLLTHCFFSQCTQGS