Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52m1 Olfactory Receptor

Gene Symbol Or52m1
Organism Mouse
Family 52
Subfamily m
Pseudo No
Location chr7:102640158-102641198 (+)
Aliases Olfr554, MOR25-1, MOR25-1

Sequence information


Nucleotide sequence

ATGGCCCAAGAATACTGTTTTTTTTTTCTTTCTAGGGAAAAATGTCTTGCTACATTTGGG
GACACAAATGAGAATTATTTATATACAACAATGTCCACTTTTCATAATGTATGTTCAGTA
CCCAGCTCTTTGTGGCTCACCGGCATCCCAGGACTGGAGACCTTGCACATATGGCTCTCC
ATTCCCTTTGGCTCCATGTACCTGGTGGCTGTGGTGGGGAACATCACCATCCTAGCTGTG
GTAAGGGTAGAGCGCAGCCTGCACCAGCCCATGTACTTCTTTCTGTGCATGCTGGCTGTC
ATTGACCTGGTTCTGTCTACTTCTACTATGCCCAAACTTCTGGCGATTTTCTGGTTTGGT
GCTGGCCACATTGGCCTGGATGCCTGCTTATGCCAAATGTTTCTTATCCATTGCTTTGCT
ACTGTTGAGTCGGGCATCTTCCTTGCCATGGCTTTTGACCGCTATGTAGCCATCTGCAAT
CCACTGCGTCACAGCATGGTGCTCACTCACACAGTGGTGGGTCGTTTGGGGCTGGCTGCC
GTCCTCAGAGGAGTTCTTTACATTGGACCCCTACCACTTATGATCCGCCTGCGGTTGCCT
CTTTACAAAACCCGAGTCATCTCCCATTCCTACTGTGAGCACATGGCTGTGGTTGCCTTG
ACCTGTGGTGACAGCAGAGTTAACAATGTCTATGGCTTGAGCATTGGCTTTCTGGTGTTG
ATCCTGGATTCAGCGGCCATTGCTGCCTCCTATGTGATGATTTTCAGGGCTGTGATGGGG
CTGGCCACTCCCGAGGCTAGACTTAAAACTCTGGGGACATGTGGGTCTCATATCTGCGCC
ATTCTGATTTTCTATGTTCCCATTGCTGTTTCTTCTCTTATTCACCGGTTTGGTCACCAG
GTTCCTCCTCCAATCCACACTCTGCTGGCCAACTTCTATCTCCTCATTCCCCCTATCCTC
AATCCCATTGTCTATGCTGTTCGTACCAAGCAGATCCGGGACAGGCTTCTTCAGATCCTA
AAGACAGGAACCAAGATCAGA


Conceptual translation

MAQEYCFFFLSREKCLATFGDTNENYLYTTMSTFHNVCSVPSSLWLTGIPGLETLHIWLS
IPFGSMYLVAVVGNITILAVVRVERSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFG
AGHIGLDACLCQMFLIHCFATVESGIFLAMAFDRYVAICNPLRHSMVLTHTVVGRLGLAA
VLRGVLYIGPLPLMIRLRLPLYKTRVISHSYCEHMAVVALTCGDSRVNNVYGLSIGFLVL
ILDSAAIAASYVMIFRAVMGLATPEARLKTLGTCGSHICAILIFYVPIAVSSLIHRFGHQ
VPPPIHTLLANFYLLIPPILNPIVYAVRTKQIRDRLLQILKTGTKIR