Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or52m2 Olfactory Receptor

Gene Symbol Or52m2
Organism Mouse
Family 52
Subfamily m
Pseudo No
Location chr7:102614010-102614987 (-)
Aliases Olfr553, MOR25-2, MOR25-2

Sequence information


Nucleotide sequence

ATGTATCCCACACTCCCAAGCATGTTCGTTTCTAATAATGCCTGCTCAGTACCCAGCTCT
TTCTGGCTCACTGGCATCCCAGGATTGGAGTCCCTGCACATGTGGCTTTCCATCCCCTTT
GGCTCCATGTACCTGGTGGCTGTGGTGGGGAACATCACCATCCTGGCAGTGGTTAAGACA
GAGCGCAGCCTGCACCAGCCCATGTATTTCTTCCTGTGTATGTTGGCTGTTATTGACTTG
GTCCTGTCAACTTCTACAATGCCCAAACTATTGGCCATCTTCTGGTTTGGTGCCTGCAGC
ATTGGTCTAGACGCCTGCTTAGTTCAGATGTTCTTTGTCCACTGCTTTGCTACTGTTGAG
TCGGGCATCTTTCTTGCCATGGCTTTCGACCGCTATGTGGCCATCTGTGACCCACTACAC
CATACATCAGTACTTACCCATGCAGTGGTGGGACGCTTGGGGTTGGCTGCACTTCTCCGA
GGAGTATTCTACATTGGACCTCTTCCACTTCTAATTCGCCTAAGGCTGCCCTTTTTTCGA
ACCCAAATCATTGCCCACTCTTACTGTGAGCACATGGCTGTGGTCACTTTGGCATGTGGT
GACACAAAAGTCAATAATCTGTATGGAATGGGAATTGGTTTTCTGGTGTTAATCCTAGAC
TCCATAGCTATAACTGCATCTTATATAATGATTTTCAGAGCTGTGTTAGGATTGTCCACC
TCTGATGCCAGGTTTAAAACTTTAGGAACATGTGGTTCTCACATCTGTGCCATCCTTGTC
TTCTACATTCCTATTGCTGTTTCATCTCTCACCCATCGTTTCGGCCACAATGTGCCTTCG
CATATCCATATTCTTTTGGCCAACTTTTACCTCCTCATCCCACCCATCCTCAACCCAGTT
GTCTATGCTGTGCGCACCAAGCAGATCCGAGAGAGACTTTTGCATATTATTAAGTCTGGA
ACTCAACACAAGGACATG


Conceptual translation

MYPTLPSMFVSNNACSVPSSFWLTGIPGLESLHMWLSIPFGSMYLVAVVGNITILAVVKT
ERSLHQPMYFFLCMLAVIDLVLSTSTMPKLLAIFWFGACSIGLDACLVQMFFVHCFATVE
SGIFLAMAFDRYVAICDPLHHTSVLTHAVVGRLGLAALLRGVFYIGPLPLLIRLRLPFFR
TQIIAHSYCEHMAVVTLACGDTKVNNLYGMGIGFLVLILDSIAITASYIMIFRAVLGLST
SDARFKTLGTCGSHICAILVFYIPIAVSSLTHRFGHNVPSHIHILLANFYLLIPPILNPV
VYAVRTKQIRERLLHIIKSGTQHKDM