Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or56a4 Olfactory Receptor

Gene Symbol Or56a4
Organism Mouse
Family 56
Subfamily a
Pseudo No
Location chr7:105156745-105157842 (-)
Aliases Olfr684, GA_x6K02T2PBJ9-7786441-7785503, MOR40-8P, GA_x6K02T2PBJ9-7786441-7785503, MOR40-8P

Sequence information


Nucleotide sequence

ATGTTAATGATGATAATGATGGTGATTTTAAAACTTCACTGGGACAGGTTCAAGCGGGAT
GGAAACTTGAGATCTACTTTATCTAGAACATATCTTTTCTGTGTCACTTCACTGACTTCA
TTATGTGAGTTTTGGATTTTCAGCTTGATTGTAATTTCTTCCATGGCATTATCCAACGAT
TCTGAAGCTCCCATCTCTGAATTCCTCCTCATCTGCTTCCCCAACTACCAGACCTGGCAG
CATTGGCTGTCCCTGCCCCTCAGCCTCCTCTTCCTCCTGGCCATGGGGGCCAATGCCACC
CTTCTCATCACCATCAGGTTGGAGGCCTCTCTGCATGAGCCCATGTACTACCTGCTCAGC
CTTCTGTCCCTGCTGGACATTGTGCTCTGCCTCACTGTCATACCTAAGGTCCTGGCCATC
TTCTGGTTTGACAATAAATCTATTGGCTTCTCTTCCTGCTTCCTCCAGATGTTTGTCATG
AACAGTTTCCTGACGATGGAGTCCTGCACCTTCATGGTCATGGCTTATGACCGCTATGTG
GCCATCTGTAAGCCTCTACAGTACCCGACCGTCATCACTGATCAGTTTGTGGTTAGGGCT
GCTATCTTCATTATAAGCCGGAATGCCCTAATTTCTCTCCCAGTTCCCATTCTTTCTGCC
AGACTAAAGTACTGTGCTCAGAACATCATCAAGAACTGCATTTGCACCAACCTGTCAGTG
TCCAGGCTCTCCTGTGATGACATTACCCTCAATAAACTATATCAACTTGTAGCAGGTTGG
ACCCTGCTGGGTTCTGATCTCATTCTCATTGTACTCTCCTACTCTTTTATCTTCCGTGTT
GTGCTCAGGATCAAAGCAGAGGGAGCTGTGGCCAAAGCCCTGAGCACATGTGGTTCCCAC
TTCATCCTCATCCTCTTCTTCAGCACAGTCTTGCTGGTGCTAGTCATCACTAACCTGGCC
AGGGAGAGGATTCCCCCGGACATCCCCATCCTGCTCAATATCCTGCATCACCTCATCCCC
CCAGCTCTGAATCCCATTGTTTATGGGGTAAGAACCAGGGAGATCAAGCAGGGAATCCAG
AACTTGTTGAGGAGGTTG


Conceptual translation

MLMMIMMVILKLHWDRFKRDGNLRSTLSRTYLFCVTSLTSLCEFWIFSLIVISSMALSND
SEAPISEFLLICFPNYQTWQHWLSLPLSLLFLLAMGANATLLITIRLEASLHEPMYYLLS
LLSLLDIVLCLTVIPKVLAIFWFDNKSIGFSSCFLQMFVMNSFLTMESCTFMVMAYDRYV
AICKPLQYPTVITDQFVVRAAIFIISRNALISLPVPILSARLKYCAQNIIKNCICTNLSV
SRLSCDDITLNKLYQLVAGWTLLGSDLILIVLSYSFIFRVVLRIKAEGAVAKALSTCGSH
FILILFFSTVLLVLVITNLARERIPPDIPILLNILHHLIPPALNPIVYGVRTREIKQGIQ
NLLRRL