Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or56a5 Olfactory Receptor

Gene Symbol Or56a5
Organism Mouse
Family 56
Subfamily a
Pseudo No
Location chr7:105,143,000-105,144,000 (-)
Aliases Olfr683

Sequence information


Nucleotide sequence

MIRRQHMEAQSNTSSILAPDFLLICFPNYQTWQHWLSLPLSLLFLLAMGANATLLITIRM
EASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDNKSIGFSSCFLQMFVMNSFLTME
SCTFMVMAYDRYVAICKPLQYPSIITDQFVVRAAIFVAARNGILTMPIPILSSQLRYCAR
IIRNCICTNMSVSKLSCDDITFNKLYQFVIGWTLLGSDLILIVLSYSFILKAVLRIKAEG
AVAKALSTCGSHFILILFFSTVLLVLVITNLARERIPPDVPILLNILHHLIPPALNPIVY
GVRTREIKQGIRNLLRRRL


Conceptual translation

MIRRQHMEAQSNTSSILAPDFLLICFPNYQTWQHWLSLPLSLLFLLAMGANATLLITIRM
EASLHEPMYYLLSLLSLLDIVLCLTVIPKVLAIFWFDNKSIGFSSCFLQMFVMNSFLTME
SCTFMVMAYDRYVAICKPLQYPSIITDQFVVRAAIFVAARNGILTMPIPILSSQLRYCAR
IIRNCICTNMSVSKLSCDDITFNKLYQFVIGWTLLGSDLILIVLSYSFILKAVLRIKAEG
AVAKALSTCGSHFILILFFSTVLLVLVITNLARERIPPDVPILLNILHHLIPPALNPIVY
GVRTREIKQGIRNLLRRRL