Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or56b34 Olfactory Receptor

Gene Symbol Or56b34
Organism Mouse
Family 56
Subfamily b
Pseudo No
Location chr7:105288035-105289057 (+)
Aliases Olfr688, MOR40-16, MOR40-5, Olfr688-ps1, MOR40-16, MOR40-5, Olfr688-ps1

Sequence information


Nucleotide sequence

ATGATTTTTTTTATTTCCCTTCAATCTACAGGCAGATGTGAGAACAAGGCACTCCCGGAA
ATGGGTACTGCCCTGCATGAAACCAACAGCTCAGAGGTCCACGTGTCTGAGTTCATTCTG
CTGGGATTCCCAGGCATTCATGAATTCCAGATCTGGCTGTCCTTGCCTATGGCTCTGCTT
TACATTGTAGCTCTTGGTGCTAATCTCCTTATCTTGATCACCATCTACCTTGAGCCTACC
CTGCATCAGCCAATGTATCAGTTTCTTGGGATCTTGGCTGCAGTAGATATTGGCTTGGCT
ACCACCAGCATGCCCAAAATACTGGCCATCTTGTGGTTTGATGCCAAGACCATCAGCCTC
CCTGAGTGTTTTGCTCAGATCTATGCTATCCACACTTTTATGTGCATGGAGTCAGGCGTC
TTCCTATGCATGGCAATAGATAGATATGTAGCCATTTGTTATCCCCTCCAGTATCCTTCC
ATAGTCACTGAAGCTTTTGTAATCAAGGCCACACTGTCCATGCTGCTCAGGAATGGCCTG
TTAACCATCCCAGTGCCTGTACTAGCTGCCCAGAGACAATACTGCTCCAGGAATGAAATA
GATCACTGCCTTTGCTCTAACTTGGGGGTCATTAGTCTGGCCTGTGATGATATCACTGTT
AACAGATTCTACCAGTTGGCATTGGCCTGGCTTGTGGTAGGAAGTGACATGATTCTGGTC
TATGCTTCTTACGCTTTGATTATTCGCTCAGTGCTGAGGCTGAACTCCACTGAGGCAGCA
TCTAAGGCCCTCAGCACCTGCAGCTCCCACCTCATCCTCATTATGTTTTACTACACAGCT
ATTGTTATAGTATCTGTTACTCACCTAGCAGGAAGAAGGGTTCCCCTCATCCCTGTTCTC
CTCAATGTGATGCATATTGTCATCCCTCCATCCCTTAACCCCGTGGTATATGCCCTTAGG
ACACAGGAGCTGAAAGTGGGCTTCCGGAAGGTTTTTAGCCTGAGTGAGTTTGTGTCTAGG
AAG


Conceptual translation

MIFFISLQSTGRCENKALPEMGTALHETNSSEVHVSEFILLGFPGIHEFQIWLSLPMALL
YIVALGANLLILITIYLEPTLHQPMYQFLGILAAVDIGLATTSMPKILAILWFDAKTISL
PECFAQIYAIHTFMCMESGVFLCMAIDRYVAICYPLQYPSIVTEAFVIKATLSMLLRNGL
LTIPVPVLAAQRQYCSRNEIDHCLCSNLGVISLACDDITVNRFYQLALAWLVVGSDMILV
YASYALIIRSVLRLNSTEAASKALSTCSSHLILIMFYYTAIVIVSVTHLAGRRVPLIPVL
LNVMHIVIPPSLNPVVYALRTQELKVGFRKVFSLSEFVSRK