Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5an1 Olfactory Receptor

Gene Symbol Or5an1
Organism Mouse
Family 5
Subfamily an
Pseudo No
Location chr19:12283050-12283985 (+)
Aliases Olfr1433, MOR214-4, Olfr1433-ps1, MOR214-4, Olfr1433-ps1

Sequence information


Nucleotide sequence

ATGATTGGGGGAAGAAATATTACCAAGATCACTCAATTTATCCTCCTGGGATTCTCCGAT
TTCCCCCAAATCACAGCACTGCTTTTTGTTATGTTCCTCACCCTGTATATTACAGCACTG
ACCTGGAACCTGTCCCTTGTTGTTTTAATAAGGATGGACTCCTATCTCCATACACCTATG
TACTTCTTCCTCAGTAATCTGTCCTTTATAGACTTCTGCTATATCTCTTCTACAGTCCCA
AAGATGCTTTCCAACCTCTTCCAGGAAAAGCAAACTATCAGCTTTGTGGGCTGCATAGTT
CAATACTTTATCTTTTCCACTATGGGACTGAGTGAATCTTGCCTCATGACAGCCATGGCC
TATGACAGGTATGCTGCCATTTGTAACCCTCTTCTGTACTCATCAGTCATGTCACCCACA
CTATGTGCTCAGATGGTGATGGGAAGCTACACAGCAGGACTTGTAAGTTCTTTATCTCAG
ATATGTGTCTTGCTGCAGCTCCACTTCTGTGGATCTAATGTCATCAGACATTTCTTCTGT
GACATGCCCCAGCTGTTAAATCTATCCTGCAATGACACTTTCTTTGCACATGTCCTACTT
GTCATATTAACAATGTTTTTTGGGCTTATAAACGCCTTAGCCATCATGGTGTCCTATGGG
TATATCGCCTCGTCCATCATGAAGATCACTTCAGCAAATGGTAGGTCCAAGGCCTTCAAC
ACCTGTGCTTCTCACCTGACAGCTGTTTCTCTCTTCTATAGTTCTGGTATCTTTGTCTAT
TTGAGTTCCAGCTCTGGTGGCTCCTCCAGCTTTGACAGATTTGCATCTGTCTTCTATAGT
GTGGTGATTCCCATGTTGAATCCTTTGATATATAGTCTGAGAAACAAGGAAATCAAAGAT
GCCATGAATAGGTTGCAGAAAAAGGTAATCTGCAGC


Conceptual translation

MIGGRNITKITQFILLGFSDFPQITALLFVMFLTLYITALTWNLSLVVLIRMDSYLHTPM
YFFLSNLSFIDFCYISSTVPKMLSNLFQEKQTISFVGCIVQYFIFSTMGLSESCLMTAMA
YDRYAAICNPLLYSSVMSPTLCAQMVMGSYTAGLVSSLSQICVLLQLHFCGSNVIRHFFC
DMPQLLNLSCNDTFFAHVLLVILTMFFGLINALAIMVSYGYIASSIMKITSANGRSKAFN
TCASHLTAVSLFYSSGIFVYLSSSSGGSSSFDRFASVFYSVVIPMLNPLIYSLRNKEIKD
AMNRLQKKVICS