Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5au1 Olfactory Receptor

Gene Symbol Or5au1
Organism Mouse
Family 5
Subfamily au
Pseudo No
Location chr14:52,035,200-52,036,100 (-)
Aliases Olfr221

Sequence information


Nucleotide sequence

MERTNLSHEMEFELLGLTSDPQLQKLLFVVFLVMYAITVLGNLVMFFLIHVSTTLHTPMY
SLLKSLSLLDFCYSSTVVPQTLLNFLVERKVISYFGCMAQMFFFAGFATSECYLIAAMAY
DRYVAVCSPLLYPTIVSPNVCASLIGGSYGAGFLNSLIHTSCIFSLNFCGAHVVTHFFCD
GPPILSLSCVDTSLCEILLFIFAGFNLLSCTLTILISYLLIFIAILQMRSNQGRFKAFST
CSSHLTAVCFFFGTTLFMYLRPKSSYSLTQDRTVAVIYTAVIPMLNPLIYSLRNKDVKEA
LRRVWGWKAMG


Conceptual translation

MERTNLSHEMEFELLGLTSDPQLQKLLFVVFLVMYAITVLGNLVMFFLIHVSTTLHTPMY
SLLKSLSLLDFCYSSTVVPQTLLNFLVERKVISYFGCMAQMFFFAGFATSECYLIAAMAY
DRYVAVCSPLLYPTIVSPNVCASLIGGSYGAGFLNSLIHTSCIFSLNFCGAHVVTHFFCD
GPPILSLSCVDTSLCEILLFIFAGFNLLSCTLTILISYLLIFIAILQMRSNQGRFKAFST
CSSHLTAVCFFFGTTLFMYLRPKSSYSLTQDRTVAVIYTAVIPMLNPLIYSLRNKDVKEA
LRRVWGWKAMG