Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5c1 Olfactory Receptor

Gene Symbol Or5c1
Organism Mouse
Family 5
Subfamily c
Pseudo No
Location chr2:37331749-37332729 (+)
Aliases Olfr368, RP23-464H12.3, MGC129260, MOR178-1, RP23-464H12.3, MGC129260, MOR178-1

Sequence information


Nucleotide sequence

ATGAACTCAGAGAACTTCACCCGGTCCAGAGTTATGCCTGCTGAGTTCATTCTCTTGGGG
ATCACAAATCGTTGGGACATGCGTGTGACCCTCTTCCTGATATTCCTGCCCATCTATCTC
GTCAGCCTGCTGGGAAATGTGGGCATGGTGCTACTCATTCGTATAGATGCCAGGCTCCAC
ACACCCATGTACTTCTTCCTGGCCAACCTCTCCCTGCTGGATGCCTTCTATTCCTCTGCC
ATTGGCCCCAAGATGCTGGTTGACCTCCTACTGTCCCGTGCCACCATCCCTTATGTAGCC
TGTGCCCTCCAGATGTTTGTCTTTGCCGGGTTGGCCGATGCTGAGTGCTGCCTGTTAGCA
GTCATGGCCTATGATCGCTATGTAGCCATTGGGAACCCTCTTCTCTATACCACAGTTATG
TCACCACGTCTATGCCTGGCGCTCCTTGGGGCATCAGGCCTGGGTGGAGCAGTGAGTGCC
TTTGTACATACAACTTTCACCTTTCGCCTGAGCTTCTGTGGCTCCCTGGAAGTCAACAGC
TTCTTCTGCGATATTCCTCCACTGCTTGCCATCTCCTGCAACGACACCAGTCTCAATGAA
CTCCTTCTTTTTGCTGTCTGTGGCTTTATCCAGACAACCACAGTGTTGGCTATTGCTGTG
TCTTATGGATTCATCGCTGTTGCTGTGATCCGCATGCAGTCAGCTGAGGGCCGTCGGAGG
GCAGCTTCCACCTGTGGCTCTCACCTCACAGCTGTGTCCATCCTATATGGGACCCTTATT
TTCATGTACCTGCGTCCCAGCTCCAGCTATGCCCTGGACACGGACAAGATGGCATCTGTG
TTCTATACTCTCGTCATCCCAGCTCTCAACCCACTCATCTACAGTCTTCGAAACAAGGAA
GTCAAGGAAGCCTTCCAGCGCACTTGGCATCGATTCTGCTGCCCGGGGCGGAGCACTCGT
GACTGGCCACAGGAAGCTCAC


Conceptual translation

MNSENFTRSRVMPAEFILLGITNRWDMRVTLFLIFLPIYLVSLLGNVGMVLLIRIDARLH
TPMYFFLANLSLLDAFYSSAIGPKMLVDLLLSRATIPYVACALQMFVFAGLADAECCLLA
VMAYDRYVAIGNPLLYTTVMSPRLCLALLGASGLGGAVSAFVHTTFTFRLSFCGSLEVNS
FFCDIPPLLAISCNDTSLNELLLFAVCGFIQTTTVLAIAVSYGFIAVAVIRMQSAEGRRR
AASTCGSHLTAVSILYGTLIFMYLRPSSSYALDTDKMASVFYTLVIPALNPLIYSLRNKE
VKEAFQRTWHRFCCPGRSTRDWPQEAH