Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5d14 Olfactory Receptor

Gene Symbol Or5d14
Organism Mouse
Family 5
Subfamily d
Pseudo No
Location chr2:88049681-88050622 (-)
Aliases Olfr1162, RP23-131J21.5, MOR174-14, RP23-131J21.5, MOR174-14

Sequence information


Nucleotide sequence

ATGGTGCCAATGGAAAGAAATGTGAGTGTGGAGATTATCTTCTCCCTGTTGGGCTTCACA
GACTACCCTGAGCTTCAGATCCCCCTTTTTCTAATCTTTCTCTTCATGTACGTTATCACT
GTAGTGGGAAACCTTGGGATGATAGCACTCATCAATATCAACCCTAAGTTCCACACTCCA
ATGTACTTCTTCCTTAGCCACCTTTCCTTTGTTGACTTCTGCTACTCAACCATCATCACA
CCCAAGCTGCTTGAAAACTTGGTCCTGGCTGATAAAACTATACTTTACTTCAGCTGCATG
TTTCAGTACTTCCTGTCCTGTGTGGCTGTGGTGTCTGAGTCCTACTTACTAGCAGTTATG
GCTTATGATCGCTTCGTGGCCATCTGTAATCCCTTGCTGTATACTGTGGCCATGTCACCA
AGGCTGTGCATCCTGCTTGTGACTGGGTCATATATCTGGAGCATATTTGCTCCATTGATT
CTCCTTTGCTATGCTCTGCAGCTAAAGTTTTCAAGATTTAATGTGATCAACCACTTCTTC
TGTGAATATACTGCCCTCATTGCTGTCTCTAGTTCTGATATACACATTCCCAGCCTGCTA
CTCTTTTGTTTTGCAACCTTCAATGAAGTGAGTACACTCTTGATCATTCTCACATCTTAT
GTGTTCATTTTCGTGACGGTATTAAAAATCAAATCTGCCAGTGGACGTCGCAAAGCCTTC
TCTACCTGTGCTTCCCACCTGACTGCCATCACAATTTTTCACGGAACCATACTTTCCTTA
TACTGTATACCTAACTCCAAAAACTCTAGGCAAGTCGTTAAAGTGGCCTCTGTCTTTTAC
ACTGTTGTCAACCCCATGTTGAACCCACTGATCTACAGCCTAAGAAACAAGGATGTGAAG
GATGCTTTCCAGAAATTAGTGAGCACAAAGATCCCTCTTCAG


Conceptual translation

MVPMERNVSVEIIFSLLGFTDYPELQIPLFLIFLFMYVITVVGNLGMIALININPKFHTP
MYFFLSHLSFVDFCYSTIITPKLLENLVLADKTILYFSCMFQYFLSCVAVVSESYLLAVM
AYDRFVAICNPLLYTVAMSPRLCILLVTGSYIWSIFAPLILLCYALQLKFSRFNVINHFF
CEYTALIAVSSSDIHIPSLLLFCFATFNEVSTLLIILTSYVFIFVTVLKIKSASGRRKAF
STCASHLTAITIFHGTILSLYCIPNSKNSRQVVKVASVFYTVVNPMLNPLIYSLRNKDVK
DAFQKLVSTKIPLQ