Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5h18 Olfactory Receptor

Gene Symbol Or5h18
Organism Mouse
Family 5
Subfamily h
Pseudo No
Location chr16:59,027,000-59,028,000 (-)
Aliases Olfr186

Sequence information


Nucleotide sequence

MLHYAYFISFQAMSSKQHMEDGNTTLLTEFVLTGLTDHQGLQVPLFLLFLMIYLITVVGN
LGLIALIWSDPHLHIPMYLFLGSLAFVDAWISSAVTPNMLFDLLSKNKMISLSECMIQFF
AFAFGGTTECFLLGTMAYDRYVAICKPLLYPVIMTNRLCIRLLVSVFIGGFLHSLFHVLF
LLRLTFCNSNIIHHFYCDIIPLYNISCTDPTLNLLLVFILSGSIQVFTIMTVLVSYTLVL
FTILKMKSLQGIRKAFSTCGAHLLSVSLYYGPLLFMYVLPASQQTDGQGMMDSLFYTVII
PVLNPIIYSLRNKQVTDSLKKRLERHV


Conceptual translation

MLHYAYFISFQAMSSKQHMEDGNTTLLTEFVLTGLTDHQGLQVPLFLLFLMIYLITVVGN
LGLIALIWSDPHLHIPMYLFLGSLAFVDAWISSAVTPNMLFDLLSKNKMISLSECMIQFF
AFAFGGTTECFLLGTMAYDRYVAICKPLLYPVIMTNRLCIRLLVSVFIGGFLHSLFHVLF
LLRLTFCNSNIIHHFYCDIIPLYNISCTDPTLNLLLVFILSGSIQVFTIMTVLVSYTLVL
FTILKMKSLQGIRKAFSTCGAHLLSVSLYYGPLLFMYVLPASQQTDGQGMMDSLFYTVII
PVLNPIIYSLRNKQVTDSLKKRLERHV