Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5h26 Olfactory Receptor

Gene Symbol Or5h26
Organism Mouse
Family 5
Subfamily h
Pseudo No
Location chr16:59,167,200-59,168,100 (-)
Aliases Olfr196

Sequence information


Nucleotide sequence

MGIENTTLLTEFVLTGLSHLPQWKIPLFLLFLVIYLITIVGNLGLITLIWNDPHLHIPMY
LFLGSLAFVDTWLSSTVTPKMLLDFFSKSKLISFSECMIQFFSFGISATTECFLLAAMAY
DRYVAICKPLLYPVIMTNRLCVLLLTLSFVGGFIHVLIHESFLFRLTFCNSNIIHHFYCD
VMPLLKISCNDPSLNYLMLFIFSGSIQVFSILTILISYTLVLFSILKQKSIKSIKKAFST
CGAHLLSVSLYYGSLLFMYVRPASPQVDDQDMMDSIFYTVIIPVLNPIIYSLRNKQVKNS
LEKFLKRNT


Conceptual translation

MGIENTTLLTEFVLTGLSHLPQWKIPLFLLFLVIYLITIVGNLGLITLIWNDPHLHIPMY
LFLGSLAFVDTWLSSTVTPKMLLDFFSKSKLISFSECMIQFFSFGISATTECFLLAAMAY
DRYVAICKPLLYPVIMTNRLCVLLLTLSFVGGFIHVLIHESFLFRLTFCNSNIIHHFYCD
VMPLLKISCNDPSLNYLMLFIFSGSIQVFSILTILISYTLVLFSILKQKSIKSIKKAFST
CGAHLLSVSLYYGSLLFMYVRPASPQVDDQDMMDSIFYTVIIPVLNPIIYSLRNKQVKNS
LEKFLKRNT