Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5i1 Olfactory Receptor

Gene Symbol Or5i1
Organism Mouse
Family 5
Subfamily i
Pseudo No
Location chr2:87782536-87783483 (+)
Aliases Olfr152, MOR181-1, Olfr4-1, V1, MOR181-1, Olfr4-1, V1

Sequence information


Nucleotide sequence

ATGATCATGGAATTTACAAGTGGAAACTACACCTTGGTCACCGAATTTATCCTGTTAGGA
TTTCCAACACGGCCTGAACTCCAAATCATCTTGTTCCTTGTGTTTCTGACGTTATATGGC
ATGATTTTGATAGGGAATATTGGCTTGATGTTGTTAATTAGGATGGACCCGCACCTTCAA
ACTCCTATGTACTTTTTCCTCAGCAACCTCTCCTTTGTAGACCTTTGTTATTCCTCAGTC
ATTGTTCCCAACATGCTTGTCAATTTCCTCTCAGCAAAGAAATCTATCTCTTACCTCGGC
TGTGCACTGCAGTTTTATTTCTTCTGCACATTTGCAGACACTGAATCCTTTATCTTGGCT
GCTATGGCCTATGATCGCTATGTTGCCATCTGCAATCCTTTGTTGTACACAGTTGCAATG
TCCAGGAGCCTCTGCATATGGTTAATTGTGCTGTCATATGTTGGTGGCAACATGAGTTCT
TTGGTTCACACATCTTTTGCCTTTATTCTGAAATATTGTGACAAAAATATCATTAATCAT
TTCTTCTGTGACCTCCCTCCTCTGCTGAAGCTTTCCTGTACGGACACATCCATTAACGAG
TGGCTACTTTCCACTTATGGGAGTTCTGTGGAGATTATCTGCTTCTTCATCATCATCATC
TCCTACTTTTTCATCCTTCTCTCAGTCTTGAAGATTCGCTCTACAAGTGGGAGAAAGAAA
ACCTTCTCCACGTGTGCCTCTCACCTGACCTCCGTGGCCATCTATCAGGGCACACTTCTC
TTCATTTATTCTCGTCCCAGCTCCCTCTACTCCCCCAACACTGATAAAATAATCTCAGTG
TTCTACACTATTATCATCCCAGTGCTAAACCCATTGATTTACAGTTTGAGAAATAAAGAC
GTAAAAGATGCTGCCAAGAAAGCTCTAAGGTCTAAAATACAATCCCCA


Conceptual translation

MIMEFTSGNYTLVTEFILLGFPTRPELQIILFLVFLTLYGMILIGNIGLMLLIRMDPHLQ
TPMYFFLSNLSFVDLCYSSVIVPNMLVNFLSAKKSISYLGCALQFYFFCTFADTESFILA
AMAYDRYVAICNPLLYTVAMSRSLCIWLIVLSYVGGNMSSLVHTSFAFILKYCDKNIINH
FFCDLPPLLKLSCTDTSINEWLLSTYGSSVEIICFFIIIISYFFILLSVLKIRSTSGRKK
TFSTCASHLTSVAIYQGTLLFIYSRPSSLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKD
VKDAAKKALRSKIQSP