Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5k1 Olfactory Receptor

Gene Symbol Or5k1
Organism Mouse
Family 5
Subfamily k
Pseudo No
Location chr16:58,796,900-58,797,800 (-)
Aliases Olfr173

Sequence information


Nucleotide sequence

MVEENHTMKREFVLTGFTDHPEMKGLLFAVFFFIYLITMIGNMGLVILISKERSLHTPMY
IFLGNLAFIDSCCACAITPKMLENFFSEDRIISLYECMAQFYFLCTVETADCFLLSAMAY
DRYVAICNPLQYHTTMSKKLCLQMTTGAFIAGNLHSMVHVGLLFRLAFCGSNQINHFYCD
ILPLYRLSCVDPYINELVLFVFSGSIQVFTIGCVLISYLFIVYTIFQMKSKEGRIKAFST
CASHFLSVSLFYGSLFFMYIRPNLLEEGDKDMPAAILFTIVVPLLNPFIYSLRNKEVKNV
LQKILQKKIISKNFKQASIIV


Conceptual translation

MVEENHTMKREFVLTGFTDHPEMKGLLFAVFFFIYLITMIGNMGLVILISKERSLHTPMY
IFLGNLAFIDSCCACAITPKMLENFFSEDRIISLYECMAQFYFLCTVETADCFLLSAMAY
DRYVAICNPLQYHTTMSKKLCLQMTTGAFIAGNLHSMVHVGLLFRLAFCGSNQINHFYCD
ILPLYRLSCVDPYINELVLFVFSGSIQVFTIGCVLISYLFIVYTIFQMKSKEGRIKAFST
CASHFLSVSLFYGSLFFMYIRPNLLEEGDKDMPAAILFTIVVPLLNPFIYSLRNKEVKNV
LQKILQKKIISKNFKQASIIV