Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5m10b Olfactory Receptor

Gene Symbol Or5m10b
Organism Mouse
Family 5
Subfamily m
Pseudo No
Location chr2:85868594-85869538 (+)
Aliases Olfr1022, RP23-384L16.9, MOR196-1, RP23-384L16.9, MOR196-1

Sequence information


Nucleotide sequence

ATGCCATCCTTAAACAACACTGCAGTGATGGATTTCATTCTTGTGGGACTCACAGACAGC
CCAGTGCTGGGGAGAATCCTCTTTGTGGTGTTTCTGGTCATTTATCTTATAACACTGACA
GGAAACCTGTGTATGATTGTGCTGATCAGGACCAATTCCCACCTGCAAACACCTATGTAC
TTCTTCCTTGGCCACCTCTCCTTTGTAGACATTTGCTACTCTTCCAATGTTACTCCAAAC
ATGCTGCATGGTTTCATCTCAGACCAGAAGATCATTTCCTATGCTGGATGCTTCACACAG
TGTCTCCTCTTCATTGCTCTGGTGATCACTGAGTTTTATCTCCTTGCTTCAATGGCACTA
GACCATTATGTGGCTATTTGCAGCCCCTTGCATTACAGTACCAGGATGTCCAAGAATGTT
TGTTTCTCTCTAGTCTCATTCTCATATGTGTTTGGTTTCCTGAATGGGCTGTCTCAGACT
CTGCTCACTTTCCACCTGTCTTTCTGTGGCTCCCATGAAATCAATCACTTTTACTGTGCA
GATCCTCCTCTTATCATGCTAGCTTGCTCTGACACTCACGTTAAAAAGATGGCCATGTTT
GTTGTTGCTGGATTCACTCTAATAAGTTCTCTCTCTATCATTCTTTTCTCCTACCTGTAC
ATTTTTGCAGCCATCATGAGGATCCGTTCTGCAGAAGGCAGGCAAAAAGCCTTTTCTACA
TGTGGTTCTCACCTGACAACAGTCACCATATTTTATGAAACCCTTTTCTGCATGTATTTA
AAGCCTCCATCAGAGAGGTCAATAGAGGAGTCCAAAGTAATTGCAGTTTTTTACACTTTT
CTGAGTCCATTCCTGAACCCTTTGATCTATAGCCTAAGGAATAAGGATGTCATCAATGCT
ATGAAACAGGTGATCAAGGGGAATTTCTGTCAGAAAATTTTGGTT


Conceptual translation

MPSLNNTAVMDFILVGLTDSPVLGRILFVVFLVIYLITLTGNLCMIVLIRTNSHLQTPMY
FFLGHLSFVDICYSSNVTPNMLHGFISDQKIISYAGCFTQCLLFIALVITEFYLLASMAL
DHYVAICSPLHYSTRMSKNVCFSLVSFSYVFGFLNGLSQTLLTFHLSFCGSHEINHFYCA
DPPLIMLACSDTHVKKMAMFVVAGFTLISSLSIILFSYLYIFAAIMRIRSAEGRQKAFST
CGSHLTTVTIFYETLFCMYLKPPSERSIEESKVIAVFYTFLSPFLNPLIYSLRNKDVINA
MKQVIKGNFCQKILV