Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Mouse symbols

Mouse Or5w8 Olfactory Receptor

Gene Symbol Or5w8
Organism Mouse
Family 5
Subfamily w
Pseudo No
Location chr2:87,857,200-87,858,100 (+)
Aliases Olfr1151

Sequence information


Nucleotide sequence

MDRGNCSSVDEFIFLGITNNPVKKVALFTTFLVVYLITLLANLGIIILIRMNTQLHTPMY
FFLSNLSFCDFCYSTAIGPKMLVDLLAAEKSIPFFGCAVQFLIFCVFADSECLLLAVMAF
DRYQAISNPLLYTVNMSSMVCFMLMTGVYLVATTDGLIHTILAFRLCFCGSNEINHFFCD
LPPLYLLSCSEIQVNELALFTVFGFIELSTISGVLVSYCYIILSVLKIRSAEGRFKAFST
CTSHLTTVAIFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEA
LQRLKMKM


Conceptual translation

MDRGNCSSVDEFIFLGITNNPVKKVALFTTFLVVYLITLLANLGIIILIRMNTQLHTPMY
FFLSNLSFCDFCYSTAIGPKMLVDLLAAEKSIPFFGCAVQFLIFCVFADSECLLLAVMAF
DRYQAISNPLLYTVNMSSMVCFMLMTGVYLVATTDGLIHTILAFRLCFCGSNEINHFFCD
LPPLYLLSCSEIQVNELALFTVFGFIELSTISGVLVSYCYIILSVLKIRSAEGRFKAFST
CTSHLTTVAIFQGTMLFMYFRPSSSYSLDQDKMTSLFYTLVIPMLNPLIYSLRNKDVKEA
LQRLKMKM